CAZyme Information: SMAC_00566-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_00566-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	NW_003546235|CGC7	32569.54	4.2413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546235:2256842-2257753(+)

Full Sequence      

MLLSIPFLLLAIPFLASLAFARDVPSNLQNLYTKLLTQKSCKHPLSDRGFYSTEDGPDTY
TYCGDHLTDFKILYIRGRGKGHLANMDVDCDGLQGGAGDDGRCSIGASPDYQGITAFQET
VASYNVSGVRDLNTYVHPYVVFGNEIESDDSSLDGHKTFDPMQYGVEPLSVMAVVCNGGK
KLVYGVWGDTNGDDGAKSMVGEASLALATECGGKEMSGSNGIDEDDVLYLAFTGADAVPG
AKGAKWEAGSFEEFERSIEELGDQLVMRIAEDGSASGTVRVSWGLMVWMFVLLVGSHLGG
YWI

Enzyme Prediction     

No EC number prediction in SMAC_00566-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	15	267	1e-73	0.9590909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	2.15e-87	86	268	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA36355.3|GH75	1.88e-164	1	301	1	305
AEO60909.1|GH75	1.18e-97	21	277	18	262
AEO66412.1|GH75	1.27e-97	16	269	9	250
UKZ61740.1|GH75	1.12e-96	15	277	12	259
UNI20522.1|GH75	8.93e-96	15	273	14	260

PDB Hits     

SMAC_00566-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	5.82e-57	18	270	15	241	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	8.92e-53	19	266	15	236	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	1.12e-51	15	266	11	240	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.12e-51	15	266	11	240	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q875I9|CSN_ASPFM	3.93e-47	19	266	15	233	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999777	CS pos: 21-22. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in SMAC_00566-t26_1-p1.