CAZyme Information: SMAC_00295-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_00295-t26_1-p1
• CAZy Family: AA12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243	NW_003546235|CGC7	25131.05	7.2430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546235:1210106-1210837(+)

Full Sequence      

MLFPFFAAALLFSTWGALAAPTQPHSQLSRRSGIALPPGYSHIIFQDDFSLLPPGSQPSP
SKWIIATGTSYPNGPANWGTNEIQTYTKALSNINITSSGTLLITPLRVSGSGSGSGNVLD
SSSSTSSSSSSAAAAAAAAPDNGKDNWTSARIETVADHIACPPGGKLLMSASLKFGSAPS
PSQMGIWPSFWALGSEFRRSGKFDQWPAAGEIDIAESTNGSPDVWRLCTAGPPPAGRATS
FLG

Enzyme Prediction     

No EC number prediction in SMAC_00295-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	46	224	9.4e-24	0.5347826086956522

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	1.97e-52	42	225	3	144	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	7.62e-12	45	224	1	128	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185690	GH16_fungal_Lam16A_glucanase	1.13e-04	185	222	95	123	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185694	GH16_CCF	0.006	149	217	101	156	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI19827.1|GH16_3	6.11e-47	9	243	10	209
QPG94915.1|GH16_3	3.55e-45	32	243	47	224
AAX07660.1|GH16_3	6.31e-44	11	236	72	272
QLI64343.1|GH16_3	3.52e-43	18	236	17	198
QBZ61307.1|GH16_3	9.50e-43	11	236	72	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	4.62e-36	38	243	5	175	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	7.03e-34	32	243	1	174	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
2HYK_A	6.88e-13	43	232	9	144	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
3ILN_A	1.96e-06	43	224	7	136	Chain A, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]

Swiss-Prot Hits     

SMAC_00295-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000300	0.999676	CS pos: 19-20. Pr: 0.9840

TMHMM  Annotations     

There is no transmembrane helices in SMAC_00295-t26_1-p1.