CAZyme Information: SMAC_00220-t26_1-p1

Basic Information

• Species: Sordaria macrospora
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Sordaria; Sordaria macrospora
• CAZyme ID: SMAC_00220-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686		76817.61	4.9656

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Smacrosporak-hell	11311	771870	484	10827

• Gene Location: location=NW_003546235:954912-957102(-)

Full Sequence      

MVSRLLGAAVPLAAAILPGARALYANGSVTAPCDSPIYCYGELLHQVELARPFSDSKTFV
DMPTIKPVDEVLEAFSKLTLPLTNNSELHEFLNTYFGPAGGELEAVPTDQLHVSPAFLDN
VNDDVIKQFVDSVINIWPDLTRKYVGAGDTCTGCANSFIPVNRTFVVAGGRFREPYYWDS
FWILEGLLRTGGAFTEISKNTIENFLDLVEELGFVPNGARLYYLNRSQPPLLTQMVRIYV
EHTNDTSILERAVPILKKEWDWWVTNRTVEVTVDGKTYSLQRYHVDNNQPRPESYREDYI
TANNNSYYATSGIIYPEKNPLNGTQKAQLYANLASGAESGWDYSTRWLKNPNDAARDVYF
PLRSLNVLETVPIDLNSILYQNEVTIGKFLAQQGNKDEADEWAKKAAQRSEAMYKLMWNS
TLWSYFDYNLTSSSQNIYVPADPKVFSFEQPSGTPEGYQVLFSINQMFPFWTGAAPDQLK
ANPLAVKLAFDRVKNFLDNKAGGIPATNFITGQQWDEPNVWPPLMHVLMDGLLNTPATFG
EDDPAYQETQNLALRLAQRYVDSTFCTWYATGGSTSETPKLQGLGSEAKGIMFEKYSDNS
TNVAGGGGEYEVVEGFGWTNGVLIWAADKFGDKLKRPDCGDITPAHVGKEKRAVELDAFD
AKFTKKFARRGKLEKLKAKFKRRAAI

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	53	628	5e-159	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	6.65e-133	53	631	3	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	3.33e-125	51	631	25	545	alpha,alpha-trehalase
224541	TreA	2.84e-87	35	636	53	558	Neutral trehalase [Carbohydrate transport and metabolism].
183934	treF	7.19e-76	40	622	59	538	alpha,alpha-trehalase TreF.
237326	treA	4.19e-75	3	622	9	528	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA35900.1|GH37	0.0	1	686	1	692
AEO70020.1|GH37	0.0	14	669	13	678
AEO53147.1|GH37	0.0	8	669	6	677
CAP59879.1|GH37	0.0	7	667	12	700
CDP22522.1|GH37	0.0	7	667	12	700

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	3.66e-70	55	631	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	5.11e-69	55	631	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	2.97e-65	35	638	46	547	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	1.14e-63	36	628	10	500	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	5.64e-61	36	628	10	500	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	1.95e-126	23	639	39	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	9.73e-118	23	634	15	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|A8J4S9|TREA_APIME	2.69e-114	24	638	32	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|P19813|TREA_RABIT	3.78e-114	32	634	27	553	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|O43280|TREA_HUMAN	3.70e-112	32	634	27	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000265	0.999707	CS pos: 22-23. Pr: 0.9647

TMHMM  Annotations     

There is no transmembrane helices in SMAC_00220-t26_1-p1.