CAZyme Information: SJAG_04868-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_04868-t26_1-p1
• CAZy Family: GT50
• CAZyme Description: chitin synthase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857		96879.47	8.2092

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651167:2309419-2312097(+)

Full Sequence      

MVAWRRKPLPQSPIAQEEERVGLRVVSPSAAEKSANSRNSFDLADYYADGTEKRNGEEFA
FDLDDYLHDEADGSEAYIPFEGITAQPYWDEDGIYDVSRTAAAVNTFKEKLRKSSMRRKT
VRCVELFRGNLVLDCPVPQKLLVTLPQQTDREFTHMRYTAATCDPVDFVSNQFTLRQPLY
SQPRKTELCIAITMYNEDEGLFARTLHSIMKNISHLCRRSRSSVWGEEAWKKVVVCIISD
GRTKIHPRTLAYLAAIGVYQDGIAKNAVNNKPVTAHIYEYTTQLSIDPSLKFKGFERGIM
PAQIIFCLKEKNQKKINSHRWFFQAFSQILQPNICVLIDAGTRPGDESIYHLWKAFDLDP
KIAGACGEIVAMKGRGGANLLNPLVAAQNFEYKMSNILDKPLESVFGFISVLPGAFSAYR
YVALQNDAYGNGPLASYFKGEIQQGRGSGIFEANMYLAEDRILCFELISKRSEAWKLHYV
KSAYADTDVPDRLPEFISQRRRWLNGSFFTGLYAVFHNYKIFRSAHSPYRKFFLGVEAFY
QFLTMLYSWFNLANFYIIFYILANSVAQSAADFAPGAVLFRVTTWIYTCLLIACFVLALG
NRPQGSATLYGIIVLCYALLMCYLLFCTIWLSFKGITAAIISAQASSMPYGKALLKNTFF
VNLLLSMGSTYGMYFIVSLISLDPWHMFTSFIQYLLLSPMYTNLLNVYAFCNTHDVSWGT
KGDNVMNTDLGVATAGPGGKDVELAIPTKEADIDAAYEHAVQLLAQRPLKTNPGVNAKQK
QEDYYKNIRTYVVLCWIFSNLALAGFILSFQSTNSMSVENNTTSVYLQFILWSVVALSAF
RFFGSLAYLIIRVFQGE

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	194	356	1.4e-79	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.75e-117	194	356	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	1.22e-100	190	509	1	243	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	5.11e-35	124	193	2	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	1.11e-28	305	636	115	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.36e-19	190	424	1	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA91105.1|GT2|2.4.1.16	0.0	1	857	1	859
NP_592838.1|GT2|2.4.1.16	0.0	1	857	1	859
BAA19857.1|GT2|2.4.1.16	2.34e-310	107	856	89	841
CDS05079.1|GT2	1.05e-309	112	856	119	864
VWO98184.1|GT2	1.60e-305	117	857	187	931

PDB Hits     

SJAG_04868-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30597|CHS1_SCHPO	0.0	1	857	1	859	Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chs1 PE=3 SV=2
sp|P87073|CHS1_PHYB8	4.16e-311	107	856	89	841	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30594|CHS1_RHIOL	6.93e-304	112	856	109	858	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|P30595|CHS2_RHIOL	6.84e-299	112	856	111	858	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|Q99127|CHS4_USTMA	8.54e-298	117	857	214	942	Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000001

TMHMM  Annotations     

Start	End
542	564
577	599
609	631
658	680
690	712
787	809
829	851