CAZyme Information: SJAG_04864-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_04864-t26_1-p1
• CAZy Family: GT48
• CAZyme Description: cell wall protein Asl1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		42363.17	3.9603

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651167:2319176-2320375(+)

Full Sequence      

MRTSILSTLAFAILTGKSLALPRGHRHLHRRDPEYVTVYETMYETVVTTEDADNAAYTVE
ATVYAAAADAAATNSPSSDSAVTTTFVTAAESIPTAESTSAYSSSDVQQEVSSDPATSSD
PATSTPTPTPSSTFATSTTYSSEDTASSSSAAPAATSSAVSSGSSSKRGLAWFPTNPSSW
TSAFDGYSSISWYYNWNHYTSGLSNEFVSTQHDAGDVASASEHFSNGVTVIGFNEPDLGN
AMSVSDAVSYYKQYLTPLRQAGTIGKLGSPAISNVGLDWLSQFMSQCSDCAIDFVAVHWY
GIDLSTMESMISTLASSYSLPVWLTEFACTNWDVNNLPSYDDVVALMKEAVAWLEAESSV
ERYSWFAPAADLGYGVGNNNALLDSNGALTELGQLYVSL

Enzyme Prediction     

No EC number prediction in SJAG_04864-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	185	396	5.4e-61	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.03e-71	188	396	16	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA91103.1|GH128	4.66e-93	162	398	291	530
NP_592836.1|GH128	4.66e-93	162	398	291	530
UJR38791.1|GH128	1.63e-40	165	397	107	348
UJR11186.1|GH128	4.27e-39	164	397	35	275
CBX95492.1|GH128	8.21e-33	164	399	26	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAX_A	1.19e-18	189	398	114	344	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UBC_A	1.47e-15	190	398	219	438	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UBD_A	3.30e-15	230	398	101	270	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]
6UAV_A	7.23e-14	165	399	3	256	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) [Pseudomonas viridiflava]
6UAW_A	9.62e-14	165	399	25	278	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) in complex with laminaritriose [Pseudomonas viridiflava]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	8.28e-94	162	398	291	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000470	0.999489	CS pos: 20-21. Pr: 0.9819

TMHMM  Annotations     

There is no transmembrane helices in SJAG_04864-t26_1-p1.