CAZyme Information: SJAG_04571-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_04571-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: UDP-glucose-glycoprotein glucosyltransferase Gpt1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1444	KE651168|CGC9	164731.27	4.8106

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651168:600137-604471(-)

Full Sequence      

MRWKSLLLFLSSGISLCLGARPLEIGLEAVFSKPSYLALFAETLHAESPEAFYWFLNSVS
DRPLESSSPKAAYDDLLIRLQNENVLDDETLSSFQFALALSSGAPKLAAFHSLVDEKNVE
CNSWILGRDGPSCKVPTSFSSIPKINVYEKNNLDYVYDDCSVETPTVIAVTDFGVEFAGF
HKQLMPLAESCKIRYVIRYSPSPKTTEEPLRVAGFGAHASLKRTDYLVVDDREVKISSQE
AGSVSTDNEQKLFADLDDNLEAVPEEQLEQLGSLTAQYISQQEDPLTVLRKLSQDFPLYA
HKIAGEQLNKQFIENITAFQERIIPEGTNIVSFNGIPVDVNELDAFSLLSMLRSERAIVN
DLKKLGLSPHEAQQVLCSDKFGRDSNEIVLPKFDYRDDTEGGNVIVWANDLENDPRYSEW
PTEVQNFLRPLYPGQLHMVRKQLHTVIYPVDPSSSISAQFVRDLLMTTQRVIPIQTGMVC
RASGDNVVGQVLCRAFHFLRNEADIDTALSFLLNCLQEDDKTDVWSLVEKHMPPLLRDDE
SLDSLHNILYSPFFDALMANSNSWMNRLSIDPHNRDIIVNGRIIDYGNDFHQNMLGIFIE
DIPQVQTAVAMYKLTDDDDLLDFALSDALPKRNALVYPSSKNVQRNVNLQASLNSLGLTL
NDVLLFGRKSAPITLWLITDFSAPEFGTFITTLEELQQDVSDISVVLLPNSNTTDSVSLQ
LVERVKARIAPRLSQLEDLYDLYQPEHKVKAETKELMEKYLKLVSIIGVSEHETGILMNG
RLITPLSPDSLNVDDLAELAYIERNNFVEILEDLIKNPRVCLPFLSSYLKELKTRPFQAV
GYGQTQMSFPRDSYVDKLKQHATFSYGDVETAMYSVVAIINPLSAEAQKLSVFLETLSKM
NSVFIMVILNPQQKLEELPLKRYYRYSIASVPQFDEQGNMVPPSVIFDNLPADVLLTMDL
ETRDAWVVMQKDVQLDLYNVKLPHTESNENLTPLTATYELKNILVQGYSTERQSGRPPRG
MQVLLSNKDGSYKTDTIVLANYGYFQLKGNPGIFTIAPKSGRSEEIFSIDGVNHGTTDNS
LTISGFEGVILHPTVSRNPGYENEDVLKPDAPSHKFLNKLLRPFRGAQKDEHAEINIFSL
ASGHLYERFIYIMTRSVMEHTKHTVKFWFIENFLSPSFKRDIAILAEKYKFKYEFVTYNW
PHWLRKQTEKQREIWGYKILFLDVLFPLDLEKVIFVDADQIVRADLKELMDLDLKGAPYA
YTPMCDSRTEMEGFRFWKQGYWKKYLRGMKYHISALYVVDLDRFRHMGAGDLLRRQYQLL
SADPESLSNLDQDLPNHLQRMIPIYSLPQEWLWCETWCSDESLKKAKTIDLCQNPLTKEK
KLDRARRQVTEWTTYDDEIHDLLEHELHKEEARPESIRQPQQVLQLSQQSTQSNPSSNEG
VDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1135	1382	1e-128	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1135	1402	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	1.02e-175	1135	1382	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	3.28e-59	393	611	1	221	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	8.44e-59	1135	1375	1	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
399437	UDP-g_GGTase	2.61e-41	1006	1107	1	108	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_595281.1|GT24|2.4.1.-	0.0	14	1404	13	1426
CAC38351.1|GT24|2.4.1.-	0.0	14	1404	13	1426
AAB05993.1|GT24|2.4.1.-	0.0	14	1404	13	1425
QSS63494.1|GT24	3.78e-300	2	1411	22	1482
QSS51253.1|GT24	5.30e-300	24	1413	35	1473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	1.94e-270	23	1402	11	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	7.57e-270	23	1402	11	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	1.06e-269	23	1402	11	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	1.02e-234	23	1344	4	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.53e-229	23	1402	11	1213	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	0.0	14	1404	13	1426	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU1|UGGG2_HUMAN	6.50e-213	27	1405	39	1501	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	1.97e-207	94	1426	118	1555	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	6.84e-207	31	1402	56	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.99e-204	31	1402	56	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999714	CS pos: 19-20. Pr: 0.9716

TMHMM  Annotations     

There is no transmembrane helices in SJAG_04571-t26_1-p1.