CAZyme Information: SJAG_04095-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_04095-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: alpha-1,2-galactosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474		55291.65	4.8784

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651167:3098063-3099487(-)

Full Sequence      

MRFGSHLILGSVIVIAFTVGTIWNRSWDRRMQNSAFHREKQQNEANGIASSSIPVTTVEK
TYIYTQTEHHTEYVTESVTTTSTSVVPGPTGDSNPSPEKVVMVFASNLESHPESSMYYLA
KSIVKNRRAYAERHGFKFMQRNVDNYEISKQHAPAWSKIPILREAMNTYPDAEWIWWLDH
DALIINRDFHLVNDLLRYDKLNSTIFRNRWYTPGSGISDNTITPGDYNLNDIHLIISQDW
NGINAGSMFFRNTKFTRWLLDVWIEPLFLEKSWIFAEQEVLGHMISNYPELRKRVALVSN
RLINAYSSHMEDYNWHDGDFCVHFAGCKDFGTCKENFDKFSAILDQKEGLSWRDESELPK
PEEQQQQQGQQEGQQSEQQNQPQQQQEQQSQPQQQPSQPEQQNQPQQEQSQPEQQNQPQQ
QQSQSEQQNQPQQEQQQPQQQQEQEQQNQSQSEQPYQVQAPAQPQQPSEQQNQQ

Enzyme Prediction     

EC	2.4.1.-:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	98	335	2.6e-67	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.06e-75	98	333	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	3.67e-16	87	263	117	265	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	6.06e-14	95	263	125	266	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBF58107.1|GT34|2.4.1.-	1.20e-86	1	357	1	363
NP_596837.1|GT34|2.4.1.-	1.20e-86	1	357	1	363
CAB38693.1|GT34|2.4.1.-	1.20e-86	1	357	1	363
NP_587775.1|GT34|2.4.1.-	2.48e-79	90	352	94	358
CAA19268.1|GT34|2.4.1.-	2.48e-79	90	352	94	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BSU_A	4.54e-09	117	263	54	172	Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSU_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94622|YBKD_SCHPO	2.13e-87	1	357	1	363	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	4.41e-80	90	352	94	358	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q09681|GMH2_SCHPO	3.06e-44	94	345	95	346	Probable alpha-1,2-galactosyltransferase gmh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh2 PE=3 SV=1
sp|Q09679|GMH1_SCHPO	2.90e-36	93	340	80	324	Probable alpha-1,2-galactosyltransferase gmh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh1 PE=3 SV=1
sp|Q10359|GMH3_SCHPO	3.09e-36	95	340	84	327	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.816369	0.183645

TMHMM  Annotations     

Start	End
7	24