CAZyme Information: SJAG_03804-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_03804-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: D-lactate dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	KE651167|CGC13	62873.70	7.6065

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651167:3759842-3761563(-)

Full Sequence      

MVSPSRFSLLSRFSCAQPVKLSIHRNLHTITKKQPIHHLGSRFSSSTANNQSRSSLLYGL
VCGILAGGATYFTTRYIQNRSLSRQFAVGNASVDHSPFEPVFATSKVYPKFIKELKKVLG
EDSVSIDADELERHGSSSWSSYHYVHNPNVVVYPTSTEQVSAIVKLCHKHRVPVIPFSGG
TSLEGHFSATYGGICVDFMNMDKVLEVHDADLDCIVQPAVKWEDLNDQLQSKGLFFGPDP
GPGAEIGGMVGTGCSGTNAARYGTMRENVLSITAVLADGTIVKTRRRPRKSSAGYDLTHL
FIGSEGTLGLVTEITLKLHAIPPCRNVAVCQFESIHDAATTVQNIMRQGLNVAAMELLDD
TQMRIINEALTSHWEEKPTLFFKFAGGYKAVQETIDIVGKLARKNHGGKFQFARNETEAE
SLWNARKQALWSTLAFAKEDLQVWTTDVCVPLSRLPDLITKTQKDLKDAGLLGGIVSHAG
DGNFHSFLLYDKNKPEEFEKASTLVHRLVLNAIHMDGTITGEHGIGLVKRAYLNEELSPD
TVALMRQLKCALDPLGILNPGHVLPQPGESVSH

Enzyme Prediction     

No EC number prediction in SJAG_03804-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	145	351	5.1e-22	0.43231441048034935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178402	PLN02805	6.45e-164	25	565	13	550	D-lactate dehydrogenase [cytochrome]
223354	GlcD	2.47e-121	114	565	1	457	FAD/FMN-containing dehydrogenase [Energy production and conversion].
273050	glcD	1.27e-105	151	561	1	412	glycolate oxidase, subunit GlcD. This protein, the glycolate oxidase GlcD subunit, is similar in sequence to that of several D-lactate dehydrogenases, including that of E. coli. The glycolate oxidase has been found to have some D-lactate dehydrogenase activity. [Energy metabolism, Other]
397178	FAD-oxidase_C	2.57e-68	321	563	1	248	FAD linked oxidases, C-terminal domain. This domain has a ferredoxin-like fold.
183043	PRK11230	3.81e-59	112	565	22	473	glycolate oxidase subunit GlcD; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ31245.1|GT31	1.94e-127	136	520	536	905
AEO67281.1|AA4	7.34e-14	110	322	64	296
CDR36620.1|AA4	9.59e-14	112	284	45	235
QGA20504.1|AA4	2.99e-13	100	407	52	371
CDR40370.1|AA4	9.01e-13	91	561	38	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LPN_A	2.13e-44	150	565	56	472	Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPN_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens]
3PM9_A	4.11e-41	109	564	15	476	Chain A, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_B Chain B, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_C Chain C, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_D Chain D, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_E Chain E, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_F Chain F, Putative oxidoreductase [Rhodopseudomonas palustris]
2UUU_A	2.68e-30	106	560	89	580	alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_B alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_C alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_D alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUV_A alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_B alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_C alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_D alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum]
4BCA_A	9.96e-26	105	564	158	658	MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Tyr578Phe mutant [Cavia porcellus],4BCA_B MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Tyr578Phe mutant [Cavia porcellus],4BCA_C MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Tyr578Phe mutant [Cavia porcellus],4BCA_D MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Tyr578Phe mutant [Cavia porcellus]
4BBY_A	1.77e-25	105	364	158	427	Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_B Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_C Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_D Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BC9_A MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_B MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_C MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_D MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],5ADZ_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5AE1_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE2_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE3_A Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_B Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_C Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_D Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],6GOU_A Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_B Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_C Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_D Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12627|DLD1_KLULA	5.87e-153	54	563	47	566	D-lactate dehydrogenase [cytochrome], mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=DLD1 PE=3 SV=2
sp|P32891|DLD1_YEAST	1.73e-146	110	563	109	574	D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD1 PE=1 SV=2
sp|Q94AX4|DLD_ARATH	5.98e-142	54	565	50	562	D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
sp|F1QXM5|LDHD_DANRE	6.80e-134	103	564	27	488	Probable D-lactate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=ldhd PE=2 SV=1
sp|Q7TNG8|LDHD_MOUSE	1.47e-120	111	564	31	484	Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ldhd PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000005

TMHMM  Annotations     

There is no transmembrane helices in SJAG_03804-t26_1-p1.