CAZyme Information: SJAG_03150-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_03150-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: acetylglucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	KE651167|CGC3	43854.11	5.7312

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651167:527033-528157(+)

Full Sequence      

MVDVLRGCPPFLNWRKLLLLVFVAFNVLISVLYVYSHADSQALDNLLSRNGFGSNESTDH
ALGRKAKPKEGRYTYLTFLTPPTTEEDFYFNATRLWAYRLLHREPVKTKYEVHVMVMKGV
EEWKIQRLKKDGAKVILVDPLLPQDFVEEGAQVLTGSPRWQHMFTKLRVFELEQFDKVCI
VDSDLLILRNMDDIFDTPYATQPPQPDIAKAHNFVNPNDNERYIFVDDFSAYSVKHEDMY
PYLLAATDDRSNDHPIPVRPASMFNAGLMLLKPSKLHMQRLLTIARYPYMYEDARMMEQS
LLNLAYDEDGWFPWTRIDWSYNGVWCQPNDHPYLRAAHGKFWDTSLDEFHPMYVADWWQA
YGEMIVYHELKDAA

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	89	324	1.7e-29	0.754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227884	Gnt1	4.86e-86	54	369	54	364	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133018	GT8_Glycogenin	2.92e-33	75	364	3	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	6.12e-06	141	330	61	228	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133064	GT8_GNT1	8.66e-06	125	202	20	119	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
215090	PLN00176	1.13e-04	106	198	49	136	galactinol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_596296.1|GT8|2.4.1.-	3.81e-125	72	369	74	372
CAA16831.1|GT8|2.4.1.-	3.81e-125	72	369	74	372
CAA89962.1|GT8|2.4.1.-	1.37e-116	15	371	14	369
NP_592825.1|GT8|2.4.1.-	1.37e-116	15	371	14	369
NP_596297.1|GT8|2.4.1.-	2.38e-79	84	374	77	369

PDB Hits     

SJAG_03150-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43062|YGT9_SCHPO	6.77e-126	72	369	74	372	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|Q09680|YA0C_SCHPO	2.43e-117	15	371	14	369	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|O43061|MU136_SCHPO	4.23e-80	84	374	77	369	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q9XGN4|GOLS1_AJURE	8.30e-08	106	373	49	303	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|O22693|GOLS4_ARATH	1.49e-06	62	363	12	294	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000001

TMHMM  Annotations     

Start	End
17	36