CAZyme Information: SJAG_03149-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_03149-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: acetylglucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		45016.86	7.4971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651167:525346-526491(+)

Full Sequence      

MWERVCNLYKGSFFVLSKRKFCTFLVAAVGLLFFGVLGLIPSIKNTIVDESWWYRLVNLP
PSPRMAYVTMLTVPPRYVDAEDEERPDWYYNSTRLLVHRLVRYPETKSKYPVVVMAMRGV
DEWKLQQLREDGAIVQVVEPLHARDVVDNIDDMEVADPRWLYMFTKLRVFEMFQYDRLCF
IDSDMLPIRNMDGVFNVHEIMERKTSSSYKPPALTYRPKGSMKNAEFEEDWNAYGVDKEE
LYPYVFAAVSDPGEWHTTPPPFKDFFNAGLFVFRPSKAHWKRLRYLARKPYFYDNARMME
QSLLNFAFHSKGAFPWEHLDWTYNGVWARKTDLPFLKVIHGKLWQGADKMGFDYDTSAVW
WQAYGEMIAYHKIIYSPPFGG

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	88	340	1.6e-31	0.8015564202334631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227884	Gnt1	1.65e-104	54	371	45	363	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133018	GT8_Glycogenin	1.19e-35	65	367	1	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	8.63e-09	106	308	49	223	galactinol synthase
132996	Glyco_transf_8	6.48e-06	144	346	64	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133064	GT8_GNT1	3.11e-04	157	195	74	112	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_596297.1|GT8|2.4.1.-	1.44e-150	41	371	39	363
CAA16830.1|GT8|2.4.1.-	1.44e-150	41	371	39	363
CAA89962.1|GT8|2.4.1.-	1.61e-87	40	372	46	367
NP_592825.1|GT8|2.4.1.-	1.61e-87	40	372	46	367
NP_596296.1|GT8|2.4.1.-	1.19e-85	58	374	68	374

PDB Hits     

SJAG_03149-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43061|MU136_SCHPO	2.56e-151	41	371	39	363	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q09680|YA0C_SCHPO	2.85e-88	40	372	46	367	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|O43062|YGT9_SCHPO	2.11e-86	58	374	68	374	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|Q4PSY4|GOLS7_ARATH	2.15e-13	105	366	45	291	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
sp|O22693|GOLS4_ARATH	2.35e-12	63	366	21	294	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000004

TMHMM  Annotations     

Start	End
21	43