CAZyme Information: SJAG_02996-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_02996-t26_1-p1
• CAZy Family: GT15
• CAZyme Description: alpha-1,2-galactosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		39784.52	9.6875

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651167:213177-214202(-)

Full Sequence      

MWNPKQRSKTLATLKSFPYPKPSLNSKDSDGQKRRKWLPLVPKSNVKRALAAIALVFLLF
LCGKTLYGSSNSKIVIVVASNEGGGVREVKNRKQWALERTSLSNKVAYAKKHGYYISIKD
VGLKRRYTHEWRESWEKADLLLEAMKDFPRAEWFWWLDLTTYIMEPSKSIEKHVIDRLDK
IGTRNLTEPGAHNPLNYEPIPHEDFTGDVNMVLTQDCNGFSLGSFFIRRSEWTTRLLDVL
WDPVVYGKMHQNWAHQEQDALQHMYETHAWVRNGVIFVPQRTINAFPRGACEGSTDARFF
YDQKDRDFVVNMAGCMFGRDCTEELAFYKQLSEKLNSWRFW

Enzyme Prediction     

No EC number prediction in SJAG_02996-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	72	323	5e-77	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	5.35e-86	71	321	2	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	0.002	102	158	154	206	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_594624.1|GT34	1.04e-131	1	339	1	341
CBF58106.1|GT34	1.04e-131	1	339	1	341
CAA22585.1|GT34	1.04e-131	1	339	1	341
QWW21810.1|GT34	2.34e-110	66	341	83	356
QEL58602.1|GT34	2.34e-110	66	341	83	356

PDB Hits     

SJAG_02996-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78817|YFE6_SCHPO	1.85e-132	1	339	1	341	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|P50108|MNN10_YEAST	7.24e-108	67	336	115	383	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|Q09174|GMA12_SCHPO	3.79e-30	71	337	101	356	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|O94622|YBKD_SCHPO	1.24e-26	71	334	101	353	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q10359|GMH3_SCHPO	2.95e-17	102	321	112	320	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999963	0.000042

TMHMM  Annotations     

There is no transmembrane helices in SJAG_02996-t26_1-p1.