CAZyme Information: SJAG_02711-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_02711-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: alpha-1,6- mannanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	KE651166|CGC15	50893.92	6.9792

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651166:1304971-1306338(-)

Full Sequence      

MSSDNEFLQEALDILDRAYHEFVDTRQYRLGNAVASAETYLDNHVYLIWPVAVYIEALAD
SLKFSGRYEKKLEVVFKAMKQYWHPSMGACCASLYFDGNDDVYYDDNAQLAIGLAVAGYY
SGTSVHRRQYVNRATSIVELTIQRGWNSEKGGVAWHTRTTGPPWTNLNACSTTMAATAAC
RLAAVTNDPSRRKDMLVFAWKCILWVHDHLLNEHGLVCDGLSLENGHWKRDPIVFTYNTG
GYILSMSLLNNFPTDNQMLPNIDRLPSMLEDAVKAALDTNGALYEQACNGPFKNWADNTF
FSQILAEGLVAFSFTMPGSPLAEPAQQMVLDQARFVMKYIRDPKDGMYFRSLSLYKLNEQ
GVRIFNQLFHANKTLEPCAEDRESLKDVPLEKRPPVKTLLGNAGAARLLFCAAEIVLRRQ
SKGAPQDASAGAFMQRRPGASTASGDKLKKNCIIS

Enzyme Prediction     

No EC number prediction in SJAG_02711-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	27	345	6.6e-41	0.8044692737430168

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.85e-29	46	348	33	339	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	6.49e-05	24	347	21	316	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB16736.1|GH76	4.16e-169	3	455	2	442
NP_593606.1|GH76	4.16e-169	3	455	2	442
CAG84200.1|GH76	3.27e-56	10	416	12	407
QNP95380.1|GH76	3.27e-56	10	416	12	407
AOW00907.1|GH76	3.27e-56	10	416	12	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4Z_A	5.08e-09	68	240	194	363	Crystal Structure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	7.39e-170	3	455	2	442	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SJAG_02711-t26_1-p1.