CAZyme Information: SJAG_02649-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_02649-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: beta-glucosidase Psu2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		43297.03	4.8147

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651166:1175049-1176248(-)

Full Sequence      

MQNCKLDVAIATKNKINNELLEVGREGFRYIRSGIHSTKPYPSFFGDHQFILFQVFHSLV
STCRSFKMLSNILFSLFAIAPLCASAMPMGNHARSSKHGHVHVAETAKKSAYNVTAAIDE
AIAALGDTSSKIRVARDGGFENGVYDCSDFPEDQDGVVRLDYLGFGGWTGVQKNDGAYGT
AETCQDNTYCSYACKPGMSKTQWPSDQPSNGVSVGGLLCKDGKLYLTQNGTSSLCKSDDD
SAYVKNTLGEGVAICRTDYPGTENMVVPTFIDGGSQQPLSVVDSSSYYTWKGGETSAQYY
VNKKGKTAEEACVWGNEGDDYGNWAPMNFGSGLKDGKTWISMFINPLATSTLDYNIRVKS
DGGELSSECYYEDGEFHNADSSDGCTVAVTGGSAYFEFY

Enzyme Prediction     

No EC number prediction in SJAG_02649-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	115	399	7e-110	0.9372937293729373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	7.39e-132	142	386	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEB07556.2|GH132	2.42e-304	1	399	1	399
CAA17897.1|GH132	6.36e-158	74	399	6	319
CAB65613.1|GH132	5.86e-107	138	399	160	417
CAY80669.2|GH132	1.06e-103	127	399	71	337
AJR57453.1|GH132	1.06e-103	127	399	71	337

PDB Hits     

SJAG_02649-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43015|YBOH_SCHPO	1.13e-158	74	399	6	319	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|Q9UR09|PSU1_SCHPO	1.04e-107	138	399	160	417	Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psu1 PE=3 SV=1
sp|P46955|NCA3_YEAST	1.89e-104	127	399	71	337	Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCA3 PE=3 SV=1
sp|Q59NP5|SUN41_CANAL	1.64e-98	140	399	161	417	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|P40472|SIM1_YEAST	1.16e-95	140	399	219	475	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999945	0.000064

TMHMM  Annotations     

There is no transmembrane helices in SJAG_02649-t26_1-p1.