CAZyme Information: SJAG_02168-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_02168-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		41950.22	6.8778

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651166:148228-149313(+)

Full Sequence      

MKRLLYMGIAAFIISAVVGVRLFFVPIRLMLFDNFKDDIILRGDVDYAANETSLWSNETQ
IVPKIIHQTWKNSDVPEKWKDAQRSCQDLHPDYEYKLWTDEDIRAFIAKEYPWFLEQFDS
YPFGIMRADVVRYFILYHYGGIYLDFDVGCKRSLDPLLKYPSFLRTTTPVGISNNVMTSV
KGHPFFLMTIRYLKKYAFNYHFPYLTVMYSTGPLFLSAIWRLYRDFPIASPLHRIRIMMP
DMYTGQDWSFFNVFEGSSWHEEDAGLVFWLLRHWLALTIICSTIFLLLIHFAFGDSCRRS
NRAGRGAVHSPSLSSASSAATYVVNDKEEHLNVPFMKDYDEEASVGGGTEVIFSASKKNT
E

Enzyme Prediction     

No EC number prediction in SJAG_02168-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	77	159	3.6e-27	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.71e-73	62	303	82	327	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.01e-29	76	164	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA93694.1|GT32	1.60e-118	29	343	28	349
CCD51739.1|GT32	1.57e-98	30	279	29	275
ATZ48182.1|GT32	1.57e-98	30	279	29	275
APA07946.1|GT32	4.46e-98	30	279	29	275
QRD00626.1|GT32	8.27e-96	36	293	35	289

PDB Hits     

SJAG_02168-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	2.84e-119	29	343	28	349	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.05e-84	61	293	81	314	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.66e-81	33	279	32	271	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	7.85e-81	52	279	52	279	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.96e-57	48	273	51	275	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999490	0.000539

TMHMM  Annotations     

Start	End
5	27
198	220
274	293