CAZyme Information: SJAG_02154-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_02154-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: GFO/IDH/MocA family oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	KE651166|CGC4	41718.45	6.0113

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651166:120099-121211(+)

Full Sequence      

MARIKVAVLGTGVSASIFHFPYLEALPKQYELYACWERRATETYSKAKEKYPNIKVFTNV
DELLADTAIELVVVSLPPACHEEIVTKALNAHKHVVCEKPFTETVEEAKKLFELADKVDR
LLCVYQNRRWDGDYMTVKNLIESGRLGQIVEFESHFDRYSVSLGSKKSWKGELGYANGLL
YGIGSHLIDQAIALFGEPVGVTAKVMNQRQFPPLGLDDYYYIVLHYSADNEQLPTEVILR
STFVAPGYTPRFIVRGTKGTFVKEGFDPQEKQIAKGMKPDDPAYGKDHPDNYGSLWYTDD
VVEPDIIKETVPTTIGDYRFFYRQIAKCIENNDRSLTPVPPQHTLSVQRVISASIQGSAS
GESVTFDTHL

Enzyme Prediction     

No EC number prediction in SJAG_02154-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	3	156	1.6e-18	0.39849624060150374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
183212	PRK11579	1.16e-79	3	356	4	335	putative oxidoreductase; Provisional
223745	MviM	7.79e-75	1	364	1	338	Predicted dehydrogenase [General function prediction only].
182305	PRK10206	4.03e-63	4	322	2	301	putative oxidoreductase; Provisional
396129	GFO_IDH_MocA	9.59e-29	4	125	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
397161	GFO_IDH_MocA_C	3.91e-25	138	366	1	204	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK44969.1|GH0	2.00e-11	1	149	1	148
BBH19520.1|GH109	4.25e-10	48	273	47	295
BBI36534.1|GH109	5.70e-10	3	361	4	387
QAT16263.1|GH13|GH133|GH23|GT2|GT4|GT5	9.63e-10	62	156	37864	37958
BBI35897.1|GH109	1.02e-09	52	173	52	177

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GDO_A	1.26e-68	4	367	6	349	Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GDO_B Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
3GFG_A	1.63e-68	4	367	15	358	Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_B Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_C Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_D Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_E Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_F Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_G Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_H Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_I Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_J Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_K Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_L Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168]
3KUX_A	5.50e-58	3	355	7	337	Structure of the YPO2259 putative oxidoreductase from Yersinia pestis [Yersinia pestis]
3E82_A	1.06e-57	4	367	8	346	Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3FHL_A	2.80e-57	4	356	6	343	Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_B Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_C Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_D Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42896|YBQ3_SCHPO	5.06e-140	1	364	1	366	Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC115.03 PE=3 SV=1
sp|O13991|YEG9_SCHPO	5.32e-125	1	364	1	365	Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.09c PE=2 SV=3
sp|O32223|IOLW_BACSU	6.50e-68	4	367	14	357	scyllo-inositol 2-dehydrogenase (NADP(+)) IolW OS=Bacillus subtilis (strain 168) OX=224308 GN=iolW PE=1 SV=1
sp|P77376|YDGJ_ECOLI	1.11e-58	3	358	4	337	Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) OX=83333 GN=ydgJ PE=1 SV=2
sp|P46853|YHHX_ECOLI	1.38e-46	4	329	3	309	Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) OX=83333 GN=yhhX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000006

TMHMM  Annotations     

There is no transmembrane helices in SJAG_02154-t26_1-p1.