CAZyme Information: SJAG_01883-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_01883-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		58318.73	6.7349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651168:2545073-2546740(+)

Full Sequence      

MVHVQLGLFSQLLAYAAFGLFFQGTYALEKPWKACPNYKVFSEKRHFPAEGSLKLPLQRP
VHACRTFHSDVVENKILEVKDALGDTDLARLFENCFPNTLDTTIRWHSPEKDDPQTLVIT
GDIPAEWLRDSAHQLAPYHALAPKDKQLAMLLLGAIQTQSEMIIQFPYCNAFQPPKKSYI
HGEDNGQSDVVTPSYDPLVVFECKYELDSLASFLRLSYKYWKATSDNRIFTTKWLAAVEV
IYTVLEQQSISTFNEETGLPRNPVYSFRRRTDAGTETLALSGRGFPVQGNGTLIRSAFRP
SDDACTLQYLIPSNAMMAVELGHLQEMLSANGKHSLAQAAQSWTKKIREGIEKYGIVEHP
VFGRVYAYEVDAYGSAIFMDDANIPSLLSLPYLGFVERDDSVYLNTRKMVLSPQGNPFFL
KGRLIQGIGGPHVGLRNVWPMSLMIQAITSDNDTEISELLNIIKRSTNGLGLMHETVDVS
NFSLYTRPWFSWANSLFSELIMDLLERKPHLVKKKSA

Enzyme Prediction     

No EC number prediction in SJAG_01883-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	85	502	1.6e-164	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226068	COG3538	0.0	63	515	1	433	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
399660	Glyco_hydro_125	0.0	85	502	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
225922	SGA1	0.003	313	515	418	612	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA94706.1|GH125	1.05e-266	11	517	5	509
EGX53450.1|GH125	1.49e-185	31	512	128	627
UKZ56404.1|GH125	4.19e-182	34	512	35	531
QSZ28718.1|GH125	5.50e-181	33	512	38	533
AEO66735.1|GH125	9.24e-181	34	516	37	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	7.50e-109	59	505	23	449	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	1.41e-106	59	505	21	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	8.65e-106	59	505	43	469	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
6RQK_A	3.59e-89	78	508	18	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	4.00e-89	78	508	18	426	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.86e-267	11	517	5	509	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.043411	0.956542	CS pos: 27-28. Pr: 0.9112

TMHMM  Annotations     

There is no transmembrane helices in SJAG_01883-t26_1-p1.