CAZyme Information: SJAG_01491-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_01491-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: O-mannosyltransferase Ogm4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	KE651168|CGC3	90245.56	9.4817

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651168:1743794-1746139(+)

Full Sequence      

MAAPTTKKGDTALRRRKNATQSPKSNLTASVREKKSELDETSAGETGKSSRNTFLYSKTC
FRKALIAITVLSFLTRFWKIWDPAQVVFDEVHFGKFASYYIRGEYFFDLHPPFAKLMLAL
VAKLAGYDGHFLFDNIGDSYTENHVPYVFIRSFPAFLSSMVPPLVFLIMKESGYDVIASF
TAAAIVLFDNAHITQGRLILLDAMLVFSMVSAIYCYIRFFKLRHRPFTRSWWAWLTMTGF
CLSCTISTKYVGFFTFLSIGLSVVLELWKLWDVRTGLSVKEFLKHFYARAFTLIIFPFCL
YLFWFYVHFSILKHSGPGDSLMSAEFQETLLDNPLLVQATPLNYYDVVLLKHKSTGAFLH
SHPDRYPLRYEDGRVSSQGQQVTGYPYNDTNSYWMILPQDHYADGSKYTPGRPVMNMDVI
KLHHISTKTDLMTHDVASPYYPTNEEFTTTSVEESASSKHNFTLFQIRYENDASARAVTT
KSFPFRLVHQLTNVAMWSGPRPLPEWAHEQQEINGAKDLTKPDTIWTFDEIVDLKDPARL
HKEQRVPKKISFLRKYIELQKQMFRQNNLLKDEHPYSSVPWQWPILHHGISFWANQSENK
QIYLLGNPFGWWFMLICIFTLPIVAGILILAKQRGVSLMDQDVFLHVNRSALFFLVTWVF
HYIPFFLMGRQLFLHHYLPAHIAGCFVVGALLQLACRKRFDLPISEGAKTANTSGKVHFR
ERRNGAAIELLISILIILALLYCFYQFYPAIYGTKSLSGNGWLGLKWRDTWLMHFQKPDA
K

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	68	309	1.5e-68	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	65	777	27	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	2.08e-89	66	312	1	244	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	2.00e-58	554	769	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	2.07e-14	350	526	3	183	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	6.66e-10	340	398	2	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA16916.1|GT39|2.4.1.109	0.0	61	779	58	778
NP_596807.1|GT39|2.4.1.109	0.0	61	779	58	778
AEO54171.1|GT39	2.12e-251	1	777	1	775
APA05800.1|GT39	1.95e-248	61	777	51	771
QSZ34493.1|GT39	1.80e-247	61	777	55	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	6.06e-96	30	771	32	751	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_A	2.19e-92	63	762	50	727	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P28_A	2.81e-09	347	529	12	191	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQP_A	3.75e-09	347	529	29	208	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42933|PMT4_SCHPO	0.0	61	779	58	778	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	5.32e-211	68	769	59	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	2.56e-201	64	777	50	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|F1Q8R9|POMT2_DANRE	4.35e-110	65	771	71	754	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|Q9UKY4|POMT2_HUMAN	2.46e-105	64	771	59	748	Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999753	0.000248

TMHMM  Annotations     

Start	End
105	127
147	169
176	193
198	220
227	246
250	272
285	307
609	631
651	668
673	695
730	752