CAZyme Information: SJAG_01171-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_01171-t26_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		44828.85	4.2468

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651168:1102745-1103956(+)

Full Sequence      

MFRVLFALLLATASHALTIGRRGFDYSSDKVRGVNLGGWLVLESWITPSLFSDTSVSDEW
SLCETLGQTAAAERLTNHYNTFINESDFSKIAGYGFNAVRIPIGYWAFNVSDGEPFVQGQ
EAYLDSAISWANNAGLKVWIDLHGAPGSQNGFDNSGKKGDIGFQKGNTVDRTVEILEYII
KKYTGSDYVDTVIGIETLNEPLASDLDLDGLKEFNAAVYSKLYSTYSNVATVFHDGYISM
SNWNDGMVDPSSSGIVMDTHQYFVFSSNDCNETFENELSSVCTAGNEIASSPFKVVVGEW
SAAINFCTSWLTNMCTGSGYDNVTEDSTYITKCQNDIASWSGQFKSMLRRFVEVQMDEYE
RGAGWIFWTYKTESPSPLWDVRLLIDYGVFPQPLSDRRFSSVC

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	77	373	9.4e-109	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	7.66e-64	25	403	12	394	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.14e-08	79	300	20	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB50968.1|GH5_9|3.2.1.75	8.12e-157	5	403	12	406
NP_596461.1|GH5_9|3.2.1.75	8.12e-157	5	403	12	406
ANB12754.1|GH5_9	7.44e-127	23	403	30	413
CAG86973.2|GH5_9	7.55e-122	23	403	39	425
ADV90770.1|GH5_9	2.65e-120	10	403	7	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.03e-114	24	403	2	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	2.07e-114	24	403	2	391	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.51e-114	24	403	8	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	7.12e-114	24	403	8	397	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	7.12e-114	24	403	8	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9URU6|EXG1_SCHPO	1.44e-157	5	403	12	406	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|O93983|EXG2_WICAO	2.82e-119	24	403	35	426	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q875R9|EXG_LACK1	6.67e-118	21	403	38	437	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1
sp|Q12628|EXG_KLULA	3.90e-117	17	403	22	425	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1
sp|Q876J3|EXG_SACU7	3.69e-114	21	403	39	443	Glucan 1,3-beta-glucosidase OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) OX=659244 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999696	CS pos: 16-17. Pr: 0.9771

TMHMM  Annotations     

There is no transmembrane helices in SJAG_01171-t26_1-p1.