CAZyme Information: SJAG_00620-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_00620-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1961		201100.69	4.1062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651166:2989779-2995664(+)

Full Sequence      

MQLWILFFLLFAFFGAQVRAFQANASTNLVGYWGSNLSGKFAGQDQKRLSAYCSNSPFDV
IVLSSVVNFNKNGWPVYDFGNLCSDSVTYEGTDLKVCPQMETDIKKCQAAGKKIILSLGG
YAGDYGLGSSGDASNFAFQLWNVFGGGESIYRPFGKAVVDGFDLDIEHGSSQGYADLVKR
MHEIYKSDPDHTYYLSAAPSCAQPDALLSDSISKTSFDFLFIREFNTTLRAECKNKTGKG
FKSWLEYVENSAYNTETRLFLGLVSDKRAALDGYRDVNNMTDFVRDSKAKSDDSFGGVAL
WDVSLAYLNKVNGTTYAEYAKKALNSSYSLTTGSTSTDDGNSASVNEPAGTTTVSTSILA
TSSGKSASTVSSSKSNLHSAASSSSPSSSQTSSLTTSVISSQAAHSLSSSSHAGHASSSS
IGSSSSAFRTVQPAKENPTVSASASSMNVVGTSSYSELSASTSPSTTLSLSFSSSAAEST
PSLATSAGASSSSTAASTPVDSSSSTVTTPESTEQSSTEEIPVTSTVSTSTSSSLSPFST
STSSTSSSSTATVSSEEGAGSDSTSLDNNSSIESSTNIESQVISTPAISSSTVSTTPSVE
TSAESSAPNSSLQSSFQSQTDFSWPVSSTLESSTTTNAPDVASIVTSSSSSVTVSNAVSV
SSSSSVVNSASESTSAASSDLPFTTTFSSSSPSSVSSVSSSISISDSVSSFTAVSDSVSV
SSVPSDSSSISSVSSAFASDATYSISSFAQASIFSTETLNSEFNFSSSSADVSSPSTVLT
VPSVTSEPEASSSSFITATSLPESASAASDYSSAYEVPALHSSASTHSKHYRTSVIIVTP
VSYRTTTLTSWVHYGTGSSAVIVTTTQSVAGPVTVSTVVVPIESTSADYNNGDSVSLESS
VTTPTVATPTIISSTGSSSSAESLATSDSVSYTSSSQQPIASEDSSFTSSDLPLSSTAVL
GTSAQSLSTSASASISAQQQTFSSNVSTSVTSSTLGPLISYTQSLNVSSQILPTSTPSAS
VSTQQQFSSIDYFNASSSSIERSSYSAVSTSSLKPKVLTTIPIISTGQPTLQNSTSATRV
PISSGYSSSVETKVPVFSTVQTNYSTSPLATKSVLTNSSSVNTFSKTSLLSASSVSTSGV
SSSTNNTSYFFTYTSSSSSLTSSSPIVLSVPSVSSFTWSPNTTTSSITVSPSSTSHRLSS
VIRSASSFLNSSSNILSTWSPTASSSGVSLSTQSSSIFKHYNTSTTSEYSSTAVSSSVPA
VSSNATASTSSSALSSSIVTTPLLSSSVSAKTNSSTTSASTLYTAPTSSLQTNSSTSSLS
SLYPASLNSSTVSKVSAESSTSSRLLTLVTPTITSSSQTNSSTTLAASSTLLQSTVKASS
SAKFVNATVVSTPSTRLPSTSSTNSTTISGKKDLLPTVTVTSFTVVATDTTTFTTTDATI
TITTTDEWGYPTVLTTYSVATTDPNYYTDDDGNVITVEYVTATADSDSVPSATTTAESVP
TTDISSDLTTSVDSTTGATTDDVSPYATPTTTIVPSTTDVLATTASASVSSQVTDDSDSS
TVNTDATTGDLFTTTYTTVEWGFTNVYTSTGTSTAGSGSSNEAVTTTYTTVEWGFTNVHT
STYYLSGSATTDIATIESPTTTNPDSTTAATEATSTDAVSSAIETTFVSTDMWGFPTTVV
SSTVITGSAATSETESVSETTYVSTDEYGFSTTVTSAASTSTSETTGLDSAIAATTASES
TIISTDQWGFPTTVTSTIESTTDTLPATSTQTSESIVTTTDQWGFATTVDVVSASSSIST
STDEFETAATVVTEAGLSSTATTSEIVSTTTSSDYTLDITDSTTAIYSTSAEVETSVTDT
VTTTTAAETTTAAQATSVNSAGRWYSAVRATYSVPAGFYWSEINGIPVLEPTAGALRKRK
VVTQLPRSIVKPGEPRRTSSSNMGFIKPKAYSTFITSTIVR

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	27	270	6e-19	0.6722972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	2.72e-89	27	321	1	279	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	2.89e-12	28	222	1	172	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	1.03e-08	29	199	3	155	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
411418	ser_rich_anae_1	5.47e-07	1479	1776	231	502	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.
119349	GH18_chitinase-like	1.82e-06	76	222	28	173	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAC36921.1|GH18	6.61e-88	27	324	26	322
NP_594130.1|GH18	6.61e-88	27	324	26	322
CAG90268.1|GH18	3.62e-61	9	338	8	322
CDR43229.1|CBM19|GH18	1.10e-58	11	325	14	314
CCF55925.1|CBM19|GH18	2.68e-58	7	324	7	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	6.38e-54	24	326	3	289	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2XVN_A	3.95e-50	27	324	1	307	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
2XTK_A	4.07e-50	27	324	2	308	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
4TX6_A	4.07e-50	27	324	2	308	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
4TOQ_A	2.26e-33	32	321	6	270	Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_B Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_C Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum],4TOQ_D Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity [Punica granatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C105|YKT4_SCHPO	1.17e-88	27	324	26	322	Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB1E7.04c PE=3 SV=1
sp|P29029|CHIT_YEAST	1.51e-51	20	326	20	310	Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS1 PE=1 SV=2
sp|Q5AAH2|CHI1_CANAL	2.01e-51	25	344	16	317	Chitinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT1 PE=1 SV=1
sp|P46876|CHI1_CANAX	4.98e-51	25	344	16	317	Chitinase 1 OS=Candida albicans OX=5476 GN=CHT1 PE=3 SV=2
sp|P54197|CHI2_COCP7	2.87e-50	17	324	19	337	Endochitinase 2 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000186	0.999805	CS pos: 20-21. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in SJAG_00620-t26_1-p1.