CAZyme Information: SJAG_00442-t26_1-p1

Basic Information

• Species: Schizosaccharomyces japonicus
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces japonicus
• CAZyme ID: SJAG_00442-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: chitin synthase Chs2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893	KE651166|CGC2	101820.87	5.8081

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SjaponicusyFS275	5232	402676	346	4886

• Gene Location: location=KE651166:3332308-3335029(-)

Full Sequence      

MSRQPLEHTRRYGSRESGSSCQLTVSGSTEDGSSTEVSNPTDYTEYDVSSSVPDCDLSKV
EDYGDDRRFSMYSMRSNLRSSRPVSAAPSYRPFEYDLNGNIIESNFEEPIYEKGDWTEAP
SYISNYEVERELPKLPVITETNTLRRDVPQYSVKEVPLVDGNLIVDYSVSKQLLALQGTF
ADQPEAQTLRYSAVTCEPEETQDKGYKLRQQIYGRETEIAVCLTLEKESVHQFINTLQCV
MENIADLCSRESSRFWNTDSWQKVVVCIIADGDGDLDCSFVDVLSSLGVYQHRSGSKMVS
GSPVLAHIYEYTSCLRIDQQFYITSMESVPINLIYCKKAQSCGKVNSHRWFLNGIAKLLQ
PKVCFFIKAGTAINETAIYHIWKQFTTDNKVGGVCGNTNIELPNWYSTLCNPLLAVRNFE
LQTYKCMQYPFDSCMGYVIDIPGKFYAYRYAVLVEDAFCSEPLKDYFQKDISGSNSRKIF
GTNACLAEESLLSWSVMLRPKTDWVMKYVDTVKATIRSQNSIASYLDNAKYEVNTSLGST
LYALSRFPSIWETNHSTLRQFSLSFKVLLNSLELQVNYFAMANLFSVFYFVCHATSTSDY
DLFGHGWGNHIFVFFYYVFICLIFSQFVLALGNRPYATHSLYLGSMCISVIVCIYFLICL
FYVACKNASNSSSNGDSILGNNSFTTLLFCPLMMFLFHLITALLQLNPWHILTGSIPYVL
LLPFRVFTKNIFAFCHMHDTLQLGERKHYVDIEDGLLECVRSNNSQTIVLSIPTEEDVEN
QYHASRNNLHGDASDMTMNHIVSESQQSRMFADYTRSIRTRFVLLWALCNLVLAMILTQS
LNDTSIDDNGYVKFIFWLLFSFSALKMMGAFSYATIQLFQKLRTKVYSPKHET

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	227	385	1.5e-56	0.9815950920245399

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.86e-74	228	385	4	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
400626	Chitin_synth_1N	4.80e-26	155	224	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133033	Chitin_synth_C	2.09e-23	221	518	1	221	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	1.29e-04	329	455	51	168	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
NP_595434.1|GT2|2.4.1.16	3.80e-169	113	888	140	918
CAA21311.1|GT2|2.4.1.16	3.80e-169	113	888	140	918
AEO70950.1|GT2	2.43e-138	149	878	160	883
VDB92809.1|GT2	1.11e-136	150	876	232	951
AEO60519.1|GT2	2.34e-136	138	890	220	977

PDB Hits     

SJAG_00442-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74756|CHS2_SCHPO	6.75e-170	113	888	140	918	Chitin synthase-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chs2 PE=3 SV=1
sp|P30589|CHS2_NEUCR	2.08e-134	65	882	232	1054	Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-2 PE=3 SV=4
sp|Q92444|CHS2_PARBR	3.07e-128	150	882	239	968	Chitin synthase 2 OS=Paracoccidioides brasiliensis OX=121759 GN=CHS2 PE=3 SV=2
sp|P30584|CHSA_EMENI	1.27e-125	150	882	222	951	Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsA PE=3 SV=2
sp|Q12632|CHS1_MUCCL	1.13e-119	78	879	33	849	Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus OX=29924 GN=CHS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000006

TMHMM  Annotations     

Start	End
574	593
606	628
643	665
678	700
710	727
822	839
854	876