CAZyme Information: SHO78360.1

Basic Information

• Species: Malassezia sympodialis
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia sympodialis
• CAZyme ID: SHO78360.1
• CAZy Family: GH5
• CAZyme Description: Dolichyl-diphosphooligosaccharide--protein glycotransferase [Source:UniProtKB/TrEMBL;Acc:M5EN96]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
718		80215.24	8.1943

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MsympodialisATCC42132	4618	1230383	143	4475

• Gene Location: location=LT671824:452545-454701(+)

Full Sequence      

MAWASLETKQHAASLLRVVILLMIAGAAVSSRLFAVVRYESIIHEFDPWFNFRATKVLTK
DGYYRFWNWFDPTAWYPLGRAAGGTVFPGLMITSGTLYNILHFFHIPVNIRDVCVMLAPL
FSVFTVVAAYLFTATMKDESAGLLGALFVAIAPGYISRSVAGSYDNEAIAIFLLLFTFYL
WVRAVRDGSILYGVLTALFYFYMVAAWGGYVFITNMIPLHALVLILMGRFSERLYVAYSS
YYVIGTLASMQIPFVGFQPVRTSEHMAALGVFGLLQLIALTETVRQHVSSAQFKVLVRSA
VALVAVGALGVLVLLTSAGYIAPWTGRFYSLWDTSYAKKHIPIIASVSEHQPPSWPSYFM
DLHCLVFLFPVGVFLLFRELRDEHVFVVIYAVMGSYFSGVMVRLMLTLTPCVCVCAAVAL
STLLDVYVGRSVDGTGRRARALPMDLRLLVVGAVMVMLQLFVWHCTHITSSAYSSPSVVL
ASQTTDGSQMIIDDFREAYYWLRENTPKDAKVMSWWDYGYQIAGFADRTTLVDNNTWNNT
HIATVGKAMASSEEKAYPILRQHDVDYVLIIFGGLLGFSGDDLNKFLWMIRISQGIWPKE
IVESKFFSAAGDYSVDDNASPTMRESLMYKMSYYRFNELFGGGPGQDRARGSAGPSKSPV
LDTLDEVFTSENWLVRIYQVKKEDTLGRSLPLAAAWERGQRQKRASFPYPASAGALVH

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	16	639	1.1e-191	0.8528138528138528

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	5.58e-137	15	533	1	475	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	1.23e-113	15	688	18	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	3.61e-32	15	570	3	586	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
404170	PMT_2	4.27e-04	103	199	13	107	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
224720	ArnT	0.008	116	229	88	197	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SHO78360.1|GT66	0.0	1	718	1	718
AYO41162.1|GT66	0.0	4	713	2	716
AXA48707.1|GT66	0.0	4	713	2	716
SJX65712.1|GT66	0.0	5	715	28	793
CBQ70063.1|GT66	0.0	5	715	28	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	1.74e-298	14	710	14	712	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	5.21e-262	14	684	70	776	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6S7O_A	4.99e-260	14	689	16	703	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTG_5	2.01e-259	14	689	16	703	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6FTJ_5	2.40e-258	14	681	16	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	2.91e-307	16	703	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	8.93e-298	14	710	14	712	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|E2RG47|STT3B_CANLF	9.43e-262	14	684	70	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	2.68e-261	14	684	70	776	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	4.86e-261	14	687	67	779	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000001

TMHMM  Annotations     

Start	End
13	35
84	106
113	135
140	162
169	186
191	213
234	256
266	288
300	322
355	377
384	402
406	428
448	470