CAZyme Information: SHO76578.1

Basic Information

• Species: Malassezia sympodialis
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia sympodialis
• CAZyme ID: SHO76578.1
• CAZy Family: AA3
• CAZyme Description: GlcNAc-PI synthesis protein [Source:UniProtKB/TrEMBL;Acc:A0A1M8A2C3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1805		194108.58	7.0951

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MsympodialisATCC42132	4618	1230383	143	4475

• Gene Location: location=LT671822:31666-37152(+)

Full Sequence      

MSRAAAALAAVRARFDAPDAASGAQLVSTLRESLDLLQTPHALDGTHTGSTMSFGMDAVR
AWAAHALQAAPSVRDADVLLQDPVWDAAAQRVHDALETASPSGANRLAAATDQLLHVWDA
LTESRPPAWAHTLQSIRSGRVSPLVVQDLLLAHYGVDALDEAPTHFFTRLLDDVQAGLGQ
VRRRSHLALTFMRVAPASVPWLDALAARLARADERASEHVVAHIVQPLLEHTPHALAPLL
AALDAQRSARATMAVLLAAKARALCAIGEAPGRVPVPRGVLDACLAAAQPRLHVAALALC
VEAKSPALPLGADEAYGVRRFLAESLALPSAVARQDTLACLVKLLVRLRTSAKNGRSDAL
LRDAYEAAVRAIHPGAPYARTVLGVSLLLLLVEACAAARAPDRLYAGSPLHEAVRALHKA
HQTFPSAPLPAPRPSPAVVRRLVHLAAESTYDDIRSTAALTLMRLADDESSMLRDPSFLL
PHVVRPSVERLAAPKEADAHAAVQLLRLYHRVAVPAVHAPALACIAPVQRTGDWTADLLA
AHLARVDAQLRASPTLAHASHAGLHGSLAALTYLARAAPSVDRAPLTALVQRVWALVAPV
LCAAAPEGAEDVSEWERALAATESSADEPVAAPTATSQQILSFAWRAIKEAAALHALCAQ
DAPPDALRDANELFQTWLLQIRHRGAFSTVYPQYHALAQTLCAAPTTRALPSAWLHALLD
RVDAHADSFSTTRRSAGLGYATLALLSAQAAGSPRAAETQRVVERLARMARDAAPMRRIH
GLNMLRVLVMDSTMAQAMRAHLGEALTLAVTSFSSAHWSVRNSAMMLFAAVSTRHLGVRA
FQPTTRGPWIDSLLHASPALRPALLDTLTASAAHVGAADLAALGHGSALYAVLLLLSRTQ
SSAWPDVEALVAPLEQCTRSANAAVRSLAASCMARLVPSDQRAALVERLLRDATPRDQNA
LAGALAVVHALASPAFAPAVRARADLLEGHTCAPTLAAFIDVADACGAADAVRPFVQRVV
GEWTASPCARDPFVVWLLPTLLAAAWKQRVPVPRALLHSDADMCTALVEFLSRVPSLTDA
LEAVDWPQRETHDDLVALVLRNEAPLDARLHAARLVAQLDAPLEAHADDLLTLLLTTEHR
PLSEVLLPLVGRLCTPVRREACVCIWDMCSQPEAPVSARLGVAQALDAVPRTDERLYVIL
LRLLQDDDAEVRAAACALCPAPSVPTDAPFASVYALPRGPQACVEWVWCTAQGPAFHAHV
WRLLSQEAGADDAEADELFPSEEANQYHDATADILRAYAACREGRVPMPPDLAQRAAAAV
SRLARPVPPDPAAYRAALQDALLVRLAQQAGHCEAIDGVAERLEALLVAGDVAPAPPSRP
LRVALISDFFFPNVGGVEGHMYMVGQELLRRGHKVIVITHAYEPDRAGVRYLPGGMKVYY
VSYGVLVRQDTLPNFFALMPVLRSILVRERIELVHAHQALSNMAHEGLFHAKCLGLKTVF
TDHSLFGFADVGSILTNKLLRFALADVDHVVCVSHTGRENTVLRAALDPRDVSTIPNAVD
ARHLYPAPARPTTDGQVCIVVLSRLMYRKGIDLLLQTIPTLCARDGRIHFVIGGDGPKYV
ELEQMREQHMLQERVELVGAVRQRDVREHLTRGHIFLNTSLTEAFGTSIIEATCAGLYVV
TTRVGGIPELLPPSMMRLAEPSADAIVEATLEAIAHIRAGHHDPAQQHRQVAAMYSWAET
VQRLEMVYARAMARRPRTTTERLQRHLARGGPIGGPIICMVVGLQMIIAVLLEWVLPRDH
IECVD

Enzyme Prediction     

EC	2.4.1.198:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	1575	1714	3.8e-28	0.88125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340827	GT4_PIG-A-like	0.0	1382	1782	1	398	phosphatidylinositol N-acetylglucosaminyltransferase subunit A and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Phosphatidylinositol glycan-class A (PIG-A), an X-linked gene in humans, is necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, a very early intermediate in glycosyl phosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is an important cellular structure that facilitates the attachment of many proteins to cell surfaces. Somatic mutations in PIG-A have been associated with Paroxysmal Nocturnal Hemoglobinuria (PNH), an acquired hematological disorder.
402115	DUF2428	3.43e-49	588	819	8	256	Putative death-receptor fusion protein (DUF2428). This is a family of proteins conserved from plants to humans. The function is not known. Several members have been annotated as being HEAT repeat-containing proteins while others are designated as death-receptor interacting proteins, but neither of these could be confirmed.
340831	GT4_PimA-like	1.96e-47	1382	1748	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
400541	PIGA	2.36e-44	1420	1510	1	90	PIGA (GPI anchor biosynthesis). This domain is found on phosphatidylinositol n-acetylglucosaminyltransferase proteins. These proteins are involved in GPI anchor biosynthesis and are associated with disease the paroxysmal nocturnal haemoglobinuria.
223515	RfaB	2.22e-43	1382	1755	2	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SHO76578.1|GT4	0.0	1	1805	1	1805
AXA48490.1|GT4	0.0	26	1801	28	1775
AYO40956.1|GT4	0.0	26	1734	28	1716
CDI53026.1|GT4	5.02e-223	27	1802	48	2171
CDU25767.1|GT4	1.77e-176	1385	1802	1	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JJM_A	1.81e-14	1391	1691	23	323	Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_B Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_C Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_D Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_E Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_F Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_G Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_H Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_I Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_J Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_K Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_L Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames]
3MBO_A	2.11e-14	1391	1691	43	343	Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_B Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_C Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_D Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_E Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_F Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_G Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis],3MBO_H Crystal Structure of the Glycosyltransferase BaBshA bound with UDP and L-malate [Bacillus anthracis]
5D00_A	1.39e-08	1379	1691	4	313	Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
6TVP_A	7.58e-07	1469	1691	91	331	Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94BX4|PIGA_ARATH	1.66e-131	1376	1802	4	423	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Arabidopsis thaliana OX=3702 GN=PIGA PE=2 SV=1
sp|P87172|GPI3_SCHPO	4.02e-130	1385	1802	1	415	Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi3 PE=3 SV=1
sp|Q64323|PIGA_MOUSE	4.21e-126	1382	1802	34	453	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Mus musculus OX=10090 GN=Piga PE=2 SV=1
sp|P37287|PIGA_HUMAN	2.75e-125	1378	1802	30	452	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens OX=9606 GN=PIGA PE=1 SV=1
sp|A6ZW78|GPI3_YEAS7	2.03e-104	1382	1802	4	432	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=SPT14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

Start	End
1773	1795