CAZyme Information: SHO76394.1

Basic Information

• Species: Malassezia sympodialis
• Lineage: Basidiomycota; Malasseziomycetes; ; Malasseziaceae; Malassezia; Malassezia sympodialis
• CAZyme ID: SHO76394.1
• CAZy Family: AA3
• CAZyme Description: GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:M5E7G6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	LT671821|CGC4	65624.21	9.5908

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MsympodialisATCC42132	4618	1230383	143	4475

• Gene Location: location=LT671821:1220832-1222580(-)

Full Sequence      

MSHYFEPEFWLRICGYFLLTLVGVNWLSHVAWRQALRDTNAMKRRRILEKLGRAHSTVRY
MFVGFFHPFSNAGGGGERVLYEAISHHQRRDENIICVVYSGDIVPGEGCVTKEQILSRVQ
ERFNIKLDPTRIAFLPLFQRKLVGDKFWRMFTLAGQAYGANRLGYEALSQLVPDVFIDTM
GYAFALYPVKNFSRRIRVGAYVHYPTISTDMLQRVRRRQEGHTNAPWIATSLPVSLFKYV
YYQIFAACYGAALRSADVIVCNGSWTKSHIDELLPRRVGRPWKMAPLPRVHIVYPPCDTA
AFAELPLEGRQNRYMVSVAQFRPEKEHEMQLRILRGLLDKYPELKSSRGSNRPLRLVLIG
SCRDDEDRARLSQLRTLAKSLMIENHVEWHVDAPFSTVVQQMRHASIGLSTMVDEHFGIA
VVEYMAAGLLTLSHASAGPLQDIAVPVDGAETGFHASSLDDYVTTAYRLMVLPPDAALRI
RQAARTRATTTFSAAEFENNWRKYMWDELVPASLLAENKQALEKQAAAQRHLQQRVVPSQ
ASEAASTIEAAKSTEGAANADGGVSSAVYTSQSAVPRPARST

Enzyme Prediction     

EC	2.4.1.131:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	311	456	3.5e-18	0.78125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340835	GT4_ALG11-like	0.0	61	500	1	419	alpha-1,2-mannosyltransferase ALG11 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.
215511	PLN02949	2.19e-132	63	505	36	454	transferase, transferring glycosyl groups
406369	ALG11_N	5.86e-118	61	273	1	207	ALG11 mannosyltransferase N-terminus.
340839	GT4_GT28_WabH-like	2.12e-19	65	481	4	337	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
340831	GT4_PimA-like	7.57e-19	63	502	2	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SHO76394.1|GT4	0.0	1	582	1	582
AXA51024.1|GT4	1.05e-232	12	528	17	533
AYO43291.1|GT4	3.00e-232	12	528	17	533
CDU25735.1|GT4	4.73e-133	22	509	170	656
SJX62269.1|GT4	1.36e-131	36	509	312	781

PDB Hits     

SHO76394.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7ZW24|ALG11_DANRE	3.23e-107	63	505	63	491	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Danio rerio OX=7955 GN=alg11 PE=2 SV=2
sp|Q2TAA5|ALG11_HUMAN	4.39e-105	11	498	25	480	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG11 PE=1 SV=2
sp|Q5R7Z6|ALG11_PONAB	1.73e-104	11	498	25	480	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG11 PE=2 SV=2
sp|Q08B22|ALG11_XENLA	1.60e-103	63	501	61	477	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus laevis OX=8355 GN=alg11 PE=2 SV=2
sp|Q6P312|ALG11_XENTR	9.16e-103	63	501	63	478	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus tropicalis OX=8364 GN=alg11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

Start	End
13	32