CAZyme Information: SGZ40805.1

Basic Information

• Species: Hanseniaspora guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora guilliermondii
• CAZyme ID: SGZ40805.1
• CAZy Family: GT39
• CAZyme Description: Related to Mannosyl phosphorylinositol ceramide synthase CSH1 [Source:UniProtKB/TrEMBL;Acc:A0A1L0CPE2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		50704.45	8.9676

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HguilliermondiiUTAD222	4152	N/A	82	4070

• Gene Location: location=FQNF01000064:48346-49650(-)

Full Sequence      

MRLESKILLYSHVFLMLYLVYFFGDLLLMMVCPIKDDKDVVLDKDINKYLSAHNDDKHNL
IPKHIHQTYKTDEIPEHWIKAQKQCIDLHYPDYNYTLWTDLMVHSFLEEKYPWFLPTYDA
YEHNIQRADALRYFVLREYGGIYIDLDDVCERKLDPLLQYPAFFRKTSPLGVSNDVMGTV
PNHPLFVEFTENLERFSKINILNIPYITIMFTTGPMFVSVVYQRWIRKGWSYGLGLNKKK
LEIINKYRPRVMQPYQYKNSIGSFFSIAEGSSWHTDDSNIMFVLGAHITACVVGGFILFF
VVFYSELLIYTLLQGVIKKYNKQDNNQLDVTSVSKARFPFKLKVTRFINKLKALFGISYT
NLSEDLLPSHSINEFNNSDVGNSCNTTKSKAQIKAASPVPSGNKYNYQRHQMRRQSNLPK
EIQTQLQKASDSQV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	80	159	1.9e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.03e-62	51	328	72	335	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.53e-24	75	164	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID88375.1|GT32	4.89e-96	1	310	1	290
QID82920.1|GT32	5.19e-94	1	310	1	288
CAD6649868.1|GT32	1.16e-93	1	310	1	290
CAD6646231.1|GT32	1.16e-93	1	310	1	290
CAR23559.1|GT32	1.24e-93	1	310	1	290

PDB Hits     

SGZ40805.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	7.74e-94	1	310	1	288	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.81e-93	1	311	1	297	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.63e-73	60	323	81	334	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	6.29e-73	61	304	57	285	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.82e-42	61	280	64	268	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999915	0.000118

TMHMM  Annotations     

Start	End
7	29
199	221
282	304