CAZyme Information: SGZ40447.1

Basic Information

• Species: Hanseniaspora guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora guilliermondii
• CAZyme ID: SGZ40447.1
• CAZy Family: GT24
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A1L0D025]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	FQNF01000050|CGC1	93297.89	5.5183

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HguilliermondiiUTAD222	4152	N/A	82	4070

• Gene Location: location=FQNF01000050:57530-60070(-)

Full Sequence      

MKEFDVKKLLSELTVDEKISLLAAVDFWHTTPIERLDIPSIRVSDGPNGIRGTKFTSWEA
AKSACFPNGTALASTFDAELLEQAGALMAKEAKHKSAQIILGPTANIQRSPLGGRGFESY
SEDPYLSGIASAAIVKGIQDNGIGATMKHYACNDMDHERFAYDVKVSQRALREIYLEPFR
LAVKYADPLLFMTSYNKVNGHHCSAHKQLLDEILLKEWKSRAVVISDWYGTSHIVEGIKN
GEDIEFPGPARFRTKELVKHLLFSKAEAADGTVFTEHDIDVRVEKILNLVKYFVDINGST
KFPTAEDEKNNTAETSAFLRKVAAESIVLFKNENKLLPLKPEDDIVVIGPNAKARNASGG
GSASMKSYYTVSPYEGICNAVGKNLPYAKGCDNHKSLGNLFEQCVPKGMSGNGVAFKTYL
KPGFGADGEEPFTTVLVESSFVPMFDFDHEKLDKYKAFYATFEGTFTPEETGDYEFGCQV
LGTALFYLDGKLLINQKDKQEKGVSFFSAGTIEKTGVVSLEKGKSYEIKVEYESAYFSQI
ADSIGGGGLQVGVNKVIDIAEEIKKTAAIAAKHDKVVLVIGLNGEIESEGYDRDDMALPR
ATNELVVAVLKANPNTVVVNQSGCPVEMHWIKNAPAVLQAFYGGNELGNAIADVIFGKTN
PCGKLSITWPKRNEDNPAFLNFESHMGRVIYGEDIFVGYKYYEKKQMQVLIPFGYGLSYT
TFEHSNLKVDVNEAEDSLIVSADIKNTGDVFGKEVLQVYIGRRSKSVVPRAVKELKGFKK
IGLDPGESKTVTVKLSLKDSASYFNEYRDLWHLEAGDFYVAAGTSSDEANLLQDFTVKEE
KFWNGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	3.8e-56	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.24e-67	66	842	120	762	beta-glucosidase BglX.
224389	BglX	5.91e-58	35	392	57	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.55e-54	327	699	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	7.10e-31	9	793	56	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	8.50e-29	66	289	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG75292.1|GH3	0.0	4	843	3	837
CAG99696.1|GH3	0.0	1	846	1	845
BAO39306.1|GH3	0.0	1	846	1	845
ACY95404.1|GH3|3.2.1.21	0.0	1	846	1	845
QGN15027.1|GH3	0.0	1	846	1	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	0.0	1	846	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	0.0	3	846	3	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.82e-140	5	837	4	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.12e-101	10	826	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.54e-93	6	841	4	717	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	0.0	1	846	1	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|Q9P6J6|BGLS_SCHPO	1.71e-242	1	846	1	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	5.54e-237	1	846	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	1.33e-232	1	846	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.74e-229	1	846	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SGZ40447.1.