CAZyme Information: SGZ39968.1

Basic Information

• Species: Hanseniaspora guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora guilliermondii
• CAZyme ID: SGZ39968.1
• CAZy Family: GT2
• CAZyme Description: Peroxidase [Source:UniProtKB/TrEMBL;Acc:A0A1L0B0N7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	FQNF01000035|CGC1	37529.04	6.5019

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HguilliermondiiUTAD222	4152	N/A	82	4070

• Gene Location: location=FQNF01000035:62602-63600(+)

Full Sequence      

MFKIFSNSAYTKAIRNTALTAGFISLGYYSTTTYRNNTNETKGFIASQKFKNTKYQEVYN
DIAQLIRDNEEHDNYIGCGPVLLRLAWHASGQFDASNGIQGGSYNGTMRFDNELNDPSNA
GLGYAYNLLKPVYKKYSEQISHGDLFTLAGVVAVQEMGGPKIPWRYGRVDGNIDAMPENG
RLPDANGNANYVRNFFKRLNFLKDEEVVALIGAHCVGKTHLKNSGFEGPWGAATNMFTNE
FYKNLLNEKWNLETNGAGNKQYNNDKGYMMLPSDMALVEDKNFKKFVKKFADDEQVFFNV
FSSAFSKLLENGIHFDENTPILYFKTLDEQDL

Enzyme Prediction     

EC	1.11.1.5:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	61	312	9.1e-54	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	2.46e-107	55	316	13	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
223453	KatG	4.31e-73	48	313	62	417	Catalase (peroxidase I) [Inorganic ion transport and metabolism].
178218	PLN02608	2.94e-52	77	312	29	243	L-ascorbate peroxidase
166005	PLN02364	3.95e-47	78	312	32	246	L-ascorbate peroxidase 1
173823	plant_peroxidase_like	4.55e-47	56	310	1	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS68240.1|AA2	4.99e-120	51	332	79	357
QNG15747.1|AA2	4.99e-120	51	332	79	357
UCS22382.1|AA2	4.99e-120	51	332	79	357
UCS32843.1|AA2	4.99e-120	51	332	79	357
UCS27614.1|AA2	4.99e-120	51	332	79	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XIL_A	3.89e-115	55	332	19	294	The structure of cytochrome c peroxidase Compound I [Saccharomyces cerevisiae]
3R98_A	5.33e-115	55	332	18	293	Joint Neutron and X-ray structure of Cytochrome c peroxidase [Saccharomyces cerevisiae],3R99_A Joint Neutron and X-ray structure of Cytochrome c peroxidase [Saccharomyces cerevisiae],4XVA_A Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C],4XVA_C Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C],4XVA_E Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C],4XVA_G Crystal structure of wild type cytochrome c peroxidase [Saccharomyces cerevisiae S288C]
2XJ5_A	5.52e-115	55	332	19	294	The structure of cytochrome c peroxidase Compound II [Saccharomyces cerevisiae],2XJ8_A The structure of ferrous cytochrome c peroxidase [Saccharomyces cerevisiae]
7BIU_A	5.52e-115	55	332	19	294	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
4NFG_A	5.52e-115	55	332	19	294	K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6CW24|CCPR_KLULA	7.55e-122	54	332	71	346	Cytochrome c peroxidase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=CCP1 PE=3 SV=1
sp|Q6FMG7|CCPR_CANGA	8.87e-121	51	332	79	357	Cytochrome c peroxidase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=CAGL0K08184g PE=3 SV=1
sp|P00431|CCPR_YEAST	2.68e-113	55	332	86	361	Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCP1 PE=1 SV=2
sp|Q6BKY9|CCPR_DEBHA	1.45e-83	55	331	85	359	Cytochrome c peroxidase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=CCP1 PE=3 SV=1
sp|Q6C0Z6|CCPR_YARLI	1.58e-83	55	325	69	336	Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.964279	0.035736

TMHMM  Annotations     

There is no transmembrane helices in SGZ39968.1.