CAZyme Information: SGZ38136.1

Basic Information

• Species: Hanseniaspora guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycodaceae; Hanseniaspora; Hanseniaspora guilliermondii
• CAZyme ID: SGZ38136.1
• CAZy Family: AA2
• CAZyme Description: Related to Trehalose-phosphatase [Source:UniProtKB/TrEMBL;Acc:A0A1L0AVK0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
919	FQNF01000004|CGC1	105626.88	5.9542

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HguilliermondiiUTAD222	4152	N/A	82	4070

• Gene Location: location=FQNF01000004:107276-110035(-)

Full Sequence      

MSDNKSRIINCVTRLPYSITKITHHKSDDKSNLNVEYKIDSITGNTSLYTSLLNDDAEES
SLFDKTNISEEIILGWTGDIQYFDRYEIKTEFFESEGTTPKNELVGVEEKSFPSKSKIIN
EDDNNKLNNIHSYYTLTDPNEQIKKSQEEVNDAFDLSDKEKTYLKTRLNDEIIKINSNNQ
TKMEPIFLPATTSKKNQWLKYADKILYPDFHYILSPFLQDLKFDTTDAKKEKWIEYVKFN
EEYADKVADIYQPGDIIIIHDYHLMLLPQMIRMKLNNRNTNKHLTIGYFHHVTFPSYEYF
RSLTFRKEIVDGMLGSDVIFFQSPSFSRHFVSCCKRLLDCTWSFKSPHKDKDCNSEDPDG
VYHVSAYGNDVLIKCSPQGINKTLLIKDSFTESVDNKVQALLKAYEGKKIIFGRDRMDGC
KGILQKLQGFDTLLDMFPEWKEKIVYIQVSTPKIKTVKRQVQGINAAEMDDDAGIDDDDN
EDYELERQILELVTEINAKHGSFNYQPVQHYHMKIPKDVYLALLRVADVFFVGSIRDAIN
LSGLEYVTVQTASLMREASNSQLKLKPLILSEFSGTPLTHEDCYIINPWDSVAVARTLDK
ALNEKFTLKNKAEVRALFNKVPSLQSWSNDIISTLSSLLTVNNTITPLLSVNNLKSTYQR
AQKRLFCFDYDGTLTPIVQDPAAAIPTAKLYTTLSKLLKDERNEVWIISGRDQAFLNKWF
GDERFTSSKNKMGLSAEHGCFLKSPDSNEGWVNLTEKYNLEKWQKKCFSIMDFYTHKTPG
SFIESKKVALTWHYRRAVPELGDFCAKELKQELESVFSAEEYKNFELEVMEGKMNVEVRP
KFVNKGEIVRNLYNESNPDFVLCLGDDKTDEDMFKVLNSYGKQDGIYPVSVGSASKKTVA
KAHLSDPSRVLNTLGILTE

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	173	459	2.9e-77	0.5347368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	1.41e-165	201	919	90	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	2.11e-135	185	635	74	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	3.64e-122	185	635	77	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	5.70e-110	167	635	77	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
177855	PLN02205	4.98e-103	49	919	6	849	alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCK69939.1|GT20	7.19e-247	5	917	8	873
QID83417.1|GT20	3.07e-246	5	917	13	846
CCD22520.1|GT20	7.56e-245	5	917	9	869
CCF57257.1|GT20	9.14e-244	5	917	6	839
QHS72291.1|GT20	1.11e-243	5	917	13	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	1.24e-100	168	632	107	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	1.66e-89	642	917	1	297	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5DXN_A	4.54e-80	646	917	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	1.72e-77	646	917	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5HUV_A	1.31e-55	170	626	60	456	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	4.46e-243	5	917	13	846	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	5.73e-242	5	917	8	853	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|P78875|TPP1_SCHPO	4.15e-144	181	917	132	812	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q54NU9|TPSB_DICDI	3.91e-123	229	918	161	788	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|O14145|TPS2_SCHPO	5.65e-103	190	877	157	777	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SGZ38136.1.