CAZyme Information: SDRG_17318-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_17318-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241		26752.66	9.0883

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767395:1348-2130(+)

Full Sequence      

MVGFNTLLSLLSLALPLVSSHGIVSNPFAEFKADVMHTTYVAEIQAFLPGKFNGSPRDNA
VNFNKAFKAQSKYKTLRAMLDPHGPDCGNTLTNVARKEIPSNGKMTFQNPDTGEGFIPSH
TGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIALHSPRWQVY
KNCVPLLGYGQKPAKKPTVPMWGQCGGRAYIGYTTCVSGTRCTRINDGYFQCRPNRLLRD
E

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	10	196	2.2e-68	0.7387755102040816

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	7.15e-08	200	233	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.81e-07	201	229	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EQC24790.1|AA17|CBM1	1.72e-188	1	241	1	241
KDO29254.1|AA17|CBM1	1.25e-181	1	241	1	241
KDO29253.1|AA17|CBM1	2.28e-129	1	234	1	271
AIG56266.1|AA17|CBM1	2.77e-124	1	234	1	254
KDO29252.1|AA17|CBM1	2.63e-115	1	235	1	249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	2.93e-34	21	196	1	180	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46239|GUNF_FUSOX	8.75e-09	200	234	20	54	Putative endoglucanase type F OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P49075|GUX3_AGABI	7.57e-08	200	235	23	58	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|I1S3C6|XYND_GIBZE	1.27e-07	193	234	12	53	Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYLD PE=1 SV=1
sp|B0Y9E7|MANF_ASPFC	4.47e-07	202	234	23	55	Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=manF PE=3 SV=2
sp|Q4WBS1|MANF_ASPFU	4.47e-07	202	234	23	55	Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=manF PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000227	0.999751	CS pos: 20-21. Pr: 0.9758

TMHMM  Annotations     

There is no transmembrane helices in SDRG_17318-t26_1-p1.