CAZyme Information: SDRG_17308-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_17308-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		44343.40	6.5885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767389:2050-3344(-)

Full Sequence      

MYSTHLRLLVATVLLAALASAHVASSIRNGAVKARGVNLGAWLVTEYFMMPNSPIFQNVS
AEKRELGEHVTVTALTRPVADPLFKAHRDTWITEADIQEIASYGLNTVRVPVGWWIYEDP
EDPAWQSFSPGGLAYLDNLINNWAAKANVAVLVGMHAAKGSQNGEGHSAPPISGESHFTD
DAENVYATMQSALFLMNRYKASPAFIGLEMLNEPTVYSDRVYNIDRSKVKLYYKHLYTKL
RAICADCVIMLSPYLSEQYESFGNEWANILPAASNNWIDWHKYLIWGYENWNVNDIINVG
TQWITNDITLWQSKRPTPVFVGEWSLAAAEGILVDLSNATTMTRYANRALQAMSNAKAGW
TYWSWKIDSSDWRTFGWNMQSLLRKGIIKLNGFV

Enzyme Prediction     

No EC number prediction in SDRG_17308-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	84	373	1.7e-44	0.9855595667870036

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	8.93e-16	87	369	20	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.16e-14	83	372	65	369	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55999.1|GH5	4.62e-214	22	390	20	388
AIG56483.1|GH5	5.64e-171	6	392	1	396
AIG55998.1|GH5	2.84e-168	9	390	7	388
AIG55478.1|GH5	7.63e-135	22	390	14	375
AIG56251.1|GH5	2.07e-131	22	391	18	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	2.42e-35	35	387	10	377	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	5.07e-35	35	387	15	382	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	8.92e-35	35	387	10	377	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	9.89e-35	35	387	16	383	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	2.62e-34	35	387	16	383	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29717|EXG1_CANAL	4.88e-34	35	387	54	421	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q5B6Q3|EXGB_EMENI	5.48e-32	33	388	50	396	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|B0XN12|EXGA_ASPFC	5.44e-30	29	387	39	401	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	5.07e-29	29	387	39	401	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	2.00e-28	33	388	41	386	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999728	CS pos: 21-22. Pr: 0.9708

TMHMM  Annotations     

There is no transmembrane helices in SDRG_17308-t26_1-p1.