CAZyme Information: SDRG_17254-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_17254-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		35670.42	8.3585

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767361:7759-8766(-)

Full Sequence      

MKSYLASLALALVAIVALPQADAARVVGMYYPNRPEAPRIEDVQLKASTHVFYAFVIPNA
DGSLPTPEGLAHFAQVVRSKGAKPVLSIGGGGQSANFPPLAASAASRNTFVQAVRSLVNK
YNLEGVDIDWEFPDSDSDFNNYRVLAQQVRQALGAGKVVSAALPGWISRDQMAPIVNESL
DFVNLMLYDNVYSNDGRPNAALMGDDSSVQSAVGNWLGAGVPASKLVVGVPFYGYEGKKA
ITYRDIKPLESSWAYSMNKASFTPQLVKGSRKITYDNPASIAAKAKFTACMNLRGVFAWE
VTQDDTASSLLNALGTSYPGGNGNSDACLKKATSA

Enzyme Prediction     

No EC number prediction in SDRG_17254-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	26	309	8e-56	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	2.89e-63	26	304	1	307	Glycosyl hydrolases family 18.
214753	Glyco_18	8.94e-60	25	304	1	334	Glyco_18 domain.
119365	GH18_chitinase	2.58e-53	27	304	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119358	GH18_plant_chitinase_class_V	4.21e-45	28	310	7	299	The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes. The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity.
119351	GH18_chitolectin_chitotriosidase	1.33e-38	49	305	29	342	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55659.1|GH18	1.65e-141	9	332	12	334
UQU63378.1|CBM13|GH18	3.94e-39	37	321	50	323
AGZ40037.1|CBM13|GH18	3.10e-38	37	321	32	305
ALG15088.1|CBM13|GH18	7.25e-38	40	323	72	349
ANZ41390.1|CBM13|GH18	8.61e-38	40	324	50	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4URI_A	4.66e-31	40	304	15	322	Crystal structure of chitinase-like agglutinin RobpsCRA from Robinia pseudoacacia [Robinia pseudoacacia],4URI_B Crystal structure of chitinase-like agglutinin RobpsCRA from Robinia pseudoacacia [Robinia pseudoacacia]
6TSB_AAA	9.59e-27	51	304	57	337	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	1.24e-26	51	304	76	356	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
5XWF_A	2.74e-25	50	314	24	365	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6EPB_A	1.16e-24	49	318	65	395	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32470|CHI1_APHAL	3.19e-24	42	320	58	397	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|P48827|CHI42_TRIHA	2.87e-23	49	318	65	395	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|A0A1B1J8Z2|CHIT5_LOTJA	1.07e-22	49	304	77	382	Class V chitinase CHIT5 OS=Lotus japonicus OX=34305 GN=CHIT5 PE=1 SV=2
sp|A6N6J0|CHI46_TRIHA	1.45e-22	49	318	66	402	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|O81862|CHIC_ARATH	5.87e-22	40	307	41	356	Class V chitinase OS=Arabidopsis thaliana OX=3702 GN=ChiC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999736	CS pos: 23-24. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in SDRG_17254-t26_1-p1.