CAZyme Information: SDRG_17072-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_17072-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531		57607.79	6.8076

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767322:1875-3470(+)

Full Sequence      

MRSLLLCALSLLVALAAARDGCYNTKDVHETLVISSGSGSPDCVTNNKLLLVNGSFTGPT
LTMHKGDKLHLTIVNELDSMFSMHIHGATQFGTPFSDGAAGINAIPMQPHSSVTRSTVMH
EAGTFFYHAHLKLMDMHVYGALIVKEHGEKYDDLVLMLSDYWHADLDTLHYGLLDAPAFQ
FVGFPQAFLTNGRGNVGNCSSGVDTSLMTLRVKPRTTYRLRIIGGTSLFGVHFRIPEHKL
TIVEIEGTKVAPKAVDYVEVLPGQRYTALLTTDQPVDNYFMQIDGRWRAGAPRNGLSVLQ
YEGAPSAPTSPSTLLPYVTETVNFMDQFEPTTRLNMPATADVIVHLQGKQIAFGADGKQR
RWAMNNITYVKQMTTSVLEAVIANQLGALPDNSRPSTSITKGQVVDVVLENAVALNGVCE
MHPWHLHGHSFWVVGAGAGAYDAAAPSAAKPFKRDVVGVYPYHAAYNQPVGTAGAPCGWT
RIRFVADNVGVWPLHCHVASHFDMGMATVFVVGEDDLHNPEIVAALRAASA

Enzyme Prediction     

No EC number prediction in SDRG_17072-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	46	507	1.1e-94	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	4.71e-94	39	515	13	526	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	1.06e-85	40	515	36	549	L-ascorbate oxidase
215324	PLN02604	5.02e-72	40	513	37	547	oxidoreductase
132431	ascorbOXfungal	2.71e-68	51	516	31	535	L-ascorbate oxidase, fungal type. This model describes a family of fungal ascorbate oxidases, within a larger family of multicopper oxidases that also includes plant ascorbate oxidases (TIGR03388), plant laccases and laccase-like proteins (TIGR03389), and related proteins. The member from Acremonium sp. HI-25 is characterized.
274556	laccase	1.32e-65	29	521	5	526	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56331.1|AA1	2.93e-290	1	531	4	534
QHN91254.1|AA1	5.59e-78	41	513	54	572
QCE01521.1|AA1	8.94e-76	39	510	35	542
VDD20174.1|AA1	2.46e-75	41	522	37	552
CAG7892042.1|AA1	3.63e-74	41	522	37	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AOZ_A	4.92e-72	40	513	16	524	Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1AOZ_B Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1ASO_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASO_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASP_A X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASP_B X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASQ_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASQ_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo]
1HFU_A	1.02e-53	30	522	7	481	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	1.04e-53	30	522	7	481	Chain A, Laccase [Coprinopsis cinerea]
6H5Y_A	4.28e-48	32	517	8	471	PM1 mutant, 7D5 [Aspergillus oryzae],6H5Y_B PM1 mutant, 7D5 [Aspergillus oryzae]
3X1B_A	6.43e-47	21	510	18	489	Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus],3X1B_B Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14133|ASO_CUCSA	3.32e-75	40	513	51	560	L-ascorbate oxidase OS=Cucumis sativus OX=3659 PE=1 SV=1
sp|M4DUF2|ASO_BRARP	6.48e-74	39	513	32	543	L-ascorbate oxidase OS=Brassica rapa subsp. pekinensis OX=51351 GN=AO PE=2 SV=1
sp|Q8LPL3|ASO_ARATH	1.90e-73	41	522	37	553	L-ascorbate oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO PE=1 SV=1
sp|P24792|ASO_CUCMA	3.19e-72	40	513	46	554	L-ascorbate oxidase OS=Cucurbita maxima OX=3661 GN=AAO PE=1 SV=2
sp|P37064|ASO_CUCPM	2.53e-71	40	513	16	524	L-ascorbate oxidase OS=Cucurbita pepo var. melopepo OX=3665 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999783	CS pos: 18-19. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in SDRG_17072-t26_1-p1.