CAZyme Information: SDRG_16915-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_16915-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
955		106938.82	6.1798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767293:51944-55589(-)

Full Sequence      

MEPPRKKHPAKIAAIHPVNLSSPEAIDLPSTLQQFAELLDAAHHEYNCGKYTEGIRICEH
LYAADASRTDNLLLLGALHFQVRNFSESIFYNQQCIRIEPHFAEAFGNLGNALKEIGDMN
GAVQFYLRAIKLNPRFADVYNNLASSYMQMGATREAIETYKMALVLDPCLVDAHSNLGNL
YKAQGLVEDATECYTNAIRVKPNFAIAWSNLAGLLKDDGQLDKAIAHYKEAIRLAPDFAD
AYSNLGNALKESGQPTEAIEAYKTAIALRPEFAIAHGNLASSYFDANQIELAISTYRTAI
QLEPNYPDAYNNLGNALRDIGQLEQAISCYRTALRLKPDHPFAYNNLGNALKDKGMIKEA
IHCYMTAVRLMPRFAAAHSNLGSILKEQGKVEQALAHYQEAITIDPTFADAFSNMGNAYK
ELLRLEEAITCYSTAIRLKPAFADTYSNLAVAYKDGGRLEEALTCFRKALSLRPEFPEAL
ANYVHSLAIVCDWRSRSEDMKKILVLLERQMSVDTNLPAVQPFHALIYALPPTRSLEIAK
RFAQRAKLNVSLVDMANVRYRAKRSDERLKIGYVCANFGNHPTAHLMASVFGLHDTSRFE
VTCYATSISDQSQWRRRIETDAEHFKDISAMANGDAAHLIHNDGIHILIDLNGYTKGART
EIFALRPAPLQMAYLGFPASLGADYIQYLVADKVVVPPGDAATGFVEKMIYLPHSFVVND
HKQAYQSVLDIETCPTRGQYEVPEDKFVFCNFSQLYKLDPVTFTSWMHILKRVPNSILWL
LRYHGDDLAETNLKAEAKAHGIRESRLHFTDVVPKEEHLRRGYLADLFLDTPTYNAQTVG
CDILWSGTPMITLEGGHMAGRVASSLLQAVDLPELITKTIEEYEELAVALALDMDKLWEI
RKKLEETRTTCPLFDTQRWVRNWESGLLLAWDAHESGSSGDHIDVPDIVELTSTP

Enzyme Prediction     

No EC number prediction in SDRG_16915-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404688	Glyco_transf_41	1.98e-145	490	922	1	542	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
226428	Spy	2.14e-110	401	925	93	609	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
274350	PEP_TPR_lipo	2.13e-34	84	528	37	475	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
274350	PEP_TPR_lipo	7.22e-32	49	481	173	639	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
274350	PEP_TPR_lipo	2.17e-31	73	462	469	890	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23060.1|GT41	1.02e-192	483	951	477	943
CCA22532.1|GT41	1.60e-189	483	951	486	951
QHN85397.1|GT41	5.81e-142	484	947	507	973
QHN85396.1|GT41	5.81e-142	484	947	507	973
QHO45608.1|GT41	1.14e-141	484	947	507	973

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HGV_A	2.31e-113	485	946	149	717	Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide [Homo sapiens],5HGV_C Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide [Homo sapiens]
6TKA_AAA	3.97e-113	485	954	152	726	Chain AAA, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit [Homo sapiens]
5LWV_A	6.98e-113	485	954	174	748	Human OGT in complex with UDP and fused substrate peptide (HCF1) [Homo sapiens]
5LVV_A	6.98e-113	485	954	174	748	Human OGT in complex with UDP and fused substrate peptide (Tab1) [Homo sapiens]
5NPR_A	1.16e-112	485	946	147	715	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	3.39e-136	484	945	502	966	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	6.60e-110	485	954	471	1045	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|P81436|OGT1_RABIT	1.76e-109	485	954	471	1045	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
sp|O15294|OGT1_HUMAN	2.44e-109	485	954	471	1045	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
sp|Q27HV0|OGT1_PIG	6.51e-109	485	954	471	1045	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SDRG_16915-t26_1-p1.