CAZyme Information: SDRG_16534-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_16534-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		33803.63	5.9781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767265:54894-55856(-)

Full Sequence      

MLLLLSTTLLLAASLQSVVGHGHLVDPVPAFTDKYGDPSKFAATLNGPTVLPGSSYEQGP
DWNTDQFTKHFKASSFKTLKAFLDAYPTGGDCGITDSNGPAQPLPSTVKWANGQEGFISS
HQGPCELWCDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPEWQVYKNC
VNLSGVAPGPGPNPNPSPSPSGSSGPSPSPTPEYPSPRPSPRPSVSPTPSPSVNPNDPIQ
GWKQCGGAGYSGNTKCVNGFQCTSLSLTYSQCMPYSNNKGQVTRYGQCGGLYYTGSTECS
KDDSCVASGPWFSQCLPGAN

Enzyme Prediction     

No EC number prediction in SDRG_16534-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	10	233	3e-76	0.8979591836734694

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	1.51e-05	283	316	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
197593	fCBD	9.83e-05	242	272	3	33	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	1.58e-04	284	311	1	28	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EQC25603.1|AA17|CBM1	1.13e-180	1	285	1	285
KDO27087.1|AA17|CBM1	2.04e-157	3	285	3	285
KDO27085.1|AA17|CBM1	4.33e-156	3	284	3	300
AIG55787.1|AA17|CBM1	1.47e-115	21	285	63	362
AIG55788.1|AA17|CBM1	4.39e-96	10	274	11	262

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	9.25e-19	21	185	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

SDRG_16534-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999739	CS pos: 20-21. Pr: 0.9797

TMHMM  Annotations     

There is no transmembrane helices in SDRG_16534-t26_1-p1.