CAZyme Information: SDRG_16525-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_16525-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		33730.04	7.3610

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767265:1419-2578(+)

Full Sequence      

TVPSTCKSRGSYLDGKSCKTCPSTKNGKSFAIFWESQTDGCLDFVKSEAAQYVTHVYWGF
ATIGTDGSVDQTFQGNDATLKACIAAMKNKCIKQYASIGGASVRANFLTVNTPAAYAKFA
STAASLVQKFGFDGVDIDDESGNLGAKGDWKTNAGPNVIGYLSALRKALNGLPLASGEPK
YIVTWDELPTAFDKSCSDAGGDYSRCFEPKILQYVDEVNNMMYNAMSATMDAWLAAVPTT
WATSIGKDKLLLGQCVGKGTGSGICGDYGDAPSPKQLEAAAAAGANYKGAMLWTGSYDWV
SGKGGVIISMGKAGNYGTGLK

Enzyme Prediction     

EC	3.2.1.14:5	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	48	253	2.2e-19	0.5574324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	2.71e-15	30	224	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119365	GH18_chitinase	4.05e-14	50	223	23	209	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	1.42e-13	50	223	23	184	Glyco_18 domain.
395573	Glyco_hydro_18	1.52e-12	50	228	20	180	Glycosyl hydrolases family 18.
225862	ChiA	3.29e-12	36	223	48	251	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55900.1|GH18	7.75e-91	6	282	62	337
AIG56010.1|GH18	4.08e-67	18	320	80	386
ANE45042.1|CBM12|GH18	9.27e-08	13	170	269	428
QGG58546.1|CBM12|GH18	1.86e-07	73	169	178	274
ASO66299.1|CBM12|GH18	1.90e-07	73	169	190	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KZ6_A	5.07e-07	75	166	59	149	1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis],5KZ6_B 1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis]
5Y29_A	5.65e-07	54	140	37	128	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	5.79e-07	54	140	37	128	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
3N11_A	6.71e-07	75	166	56	146	Crystal stricture of wild-type chitinase from Bacillus cereus NCTU2 [Bacillus cereus],3N12_A Crystal stricture of chitinase in complex with zinc atoms from Bacillus cereus NCTU2 [Bacillus cereus]
3N15_A	1.60e-06	75	166	56	146	Crystal stricture of E145Q chitinase in complex with NAG from Bacillus cereus NCTU2 [Bacillus cereus]

Swiss-Prot Hits     

SDRG_16525-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000005

TMHMM  Annotations     

There is no transmembrane helices in SDRG_16525-t26_1-p1.