CAZyme Information: SDRG_16164-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_16164-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540	JH767246|CGC1	58251.44	6.5628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767246:126817-128934(+)

Full Sequence      

MVRVFLASSLSLALAHALDTTAPPTNATATTDLDDASVLKQFQAWQASPAGQFARKQGLL
ESAEAGPDPVRLAAFKETLITIAELNQKHTSATFSADNPFAAMTNDEFATYIKRAGADVQ
ATADPSRLETSTATDSMDWAPSGCVAPVKDQGVCGSCYAHAAVAAVESAMCLLSNPRKLV
TYSDQQLTSCGPGGCTGGLSLRSLNWMLANGVCTQDAYPYSNQFTSVTETCKTTCSPVKL
PFTALGKSVGEKELETNLRRQPVAATMAASSAVFKNYQSGIITSGCDTEIDHMVLAVGYG
IDAGLPFFKFKNSWGTSWGEQGYFRLQRGVGGVGTCGLATGGDFPQIAPPTFGLATARGA
FWTIDSARQRIKHRTHPNLCLDVDPTQNNKVQVWSCYDNAPNQRIAITEEKVRLNAFNGR
YLVSGQGILQFVQIWGVPFEWVVNNVDMTWRARSDGGGDKCLDAYEARNGGTVHLWPCDS
NNANQKWRFDAATGQLRHATHTGFCLDMATTTGAKPQLWTCNTPTNDLQKFTYESLSFPQ

Enzyme Prediction     

No EC number prediction in SDRG_16164-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	415	533	3e-18	0.6595744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
239068	Peptidase_C1A	2.29e-66	135	345	2	210	Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W). Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues.
395062	Peptidase_C1	7.46e-65	135	345	3	211	Papain family cysteine protease.
214761	Pept_C1	3.39e-49	135	337	3	166	Papain family cysteine protease.
185513	PTZ00203	2.37e-43	71	330	58	326	cathepsin L protease; Provisional
240310	PTZ00200	7.71e-38	103	342	208	440	cysteine proteinase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55540.1|CBM13	1.05e-200	22	539	12	599
AIG56318.1|CBM13	1.45e-144	36	515	17	557
AIG56282.1|CBM13	2.99e-118	34	515	24	561
AIG55595.1|CBM13|GH17	1.79e-36	362	531	377	553
AIG56230.1|CBM13|GH17	1.02e-34	362	533	325	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P5W_A	1.88e-42	135	345	3	215	Actinidin from Actinidia arguta planch (Sarusashi) [Actinidia arguta]
3P5U_A	5.06e-41	135	345	3	215	Actinidin from Actinidia arguta planch (Sarusashi) [Actinidia arguta],3P5V_A Actinidin from Actinidia arguta planch (Sarusashi) [Actinidia arguta],3P5X_A Actinidin from Actinidia arguta planch (Sarusashi) [Actinidia arguta]
1AEC_A	3.43e-40	137	345	5	215	CRYSTAL STRUCTURE OF ACTINIDIN-E-64 COMPLEX+ [Actinidia chinensis]
2ACT_A	3.54e-38	137	345	5	215	Chain A, ACTINIDIN PRECURSOR [Actinidia chinensis]
4YYQ_A	4.30e-36	135	339	3	208	Ficin A [Ficus carica],4YYQ_B Ficin A [Ficus carica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5HII1|ACTN_ACTDE	5.50e-41	71	345	62	341	Actinidain OS=Actinidia deliciosa OX=3627 PE=1 SV=1
sp|P43156|CYSP_HEMSP	3.44e-40	71	345	59	344	Thiol protease SEN102 OS=Hemerocallis sp. OX=29711 GN=SEN102 PE=2 SV=1
sp|P00785|ACTN_ACTCC	5.08e-39	71	345	62	341	Actinidain OS=Actinidia chinensis var. chinensis OX=1590841 GN=ACT1A PE=1 SV=5
sp|P25776|ORYA_ORYSJ	2.18e-38	66	345	55	343	Oryzain alpha chain OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0650000 PE=1 SV=2
sp|Q9LT78|RD21C_ARATH	7.03e-38	100	345	92	344	Probable cysteine protease RD21C OS=Arabidopsis thaliana OX=3702 GN=RD21C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000309	0.999650	CS pos: 17-18. Pr: 0.9517

TMHMM  Annotations     

There is no transmembrane helices in SDRG_16164-t26_1-p1.