CAZyme Information: SDRG_15656-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_15656-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		35220.16	6.7816

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767229:44652-45587(+)

Full Sequence      

MTRSTTLLLALTVLLCVGTLMLHVHLSGLGAVPFHPQHHSNTTTLPSTTLPSARHAYMLY
ATNDITACNALIMAKNIRRLGTPAHIDIVVLATTTIASSTHAALAAGGLVVVPVEPWMQP
NAPHDTWSASLTKLRIFQERGYDRVIYIDSDSWLERNLDHLFTLREAVFWAPRAYYQSNQ
PFVGSTLLVLTPSNALFAQLEVGIAAHPSDEWYDMDVLNIVWKDLYGMLPSHYVILNAHI
NSNDTFGFASADERRAMTYVHHFSEMTNGRYGKPWTRGRVRDEVNPAWHPHFYELFDLYW
AAHDEYCTWMR

Enzyme Prediction     

No EC number prediction in SDRG_15656-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	54	276	4.2e-21	0.8793774319066148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	2.26e-32	56	275	2	238	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	3.20e-21	55	305	1	239	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	5.99e-09	56	277	2	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
227884	Gnt1	5.91e-07	121	174	146	198	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	0.002	132	171	103	142	galactinol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55795.1|GT8	1.26e-128	41	307	105	369
QVM12485.1|GT8	2.44e-19	3	282	20	305
QSS51045.1|GT8	3.22e-18	53	277	72	307
QUC20629.1|GT8	4.61e-18	39	286	36	297
BCS16636.1|GT8	9.67e-18	45	286	45	300

PDB Hits     

SDRG_15656-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	4.73e-16	53	275	153	392	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q4WBL2|GNT1_ASPFU	3.64e-13	53	275	78	326	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q9FZ37|GUX4_ARATH	2.39e-11	14	200	229	410	Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=GUX4 PE=3 SV=1
sp|Q8W4A7|GUX3_ARATH	1.98e-09	68	311	299	526	Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 3 OS=Arabidopsis thaliana OX=3702 GN=GUX3 PE=2 SV=1
sp|Q9LSB1|GUX1_ARATH	3.64e-09	65	275	333	533	UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GUX1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.759540	0.240475

TMHMM  Annotations     

Start	End
7	29