CAZyme Information: SDRG_15444-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_15444-t26_1-p1
• CAZy Family: GT33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
933		102603.05	6.8690

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767223:19508-22588(-)

Full Sequence      

MSNLFERILVPVSPSTVGHNFNNADTFKSGKYGNATNKCLSSSDPTSGKMMRCSAVWWTA
LALAAWRPLAAFALRTNMRELTRWTFRNSNGSIAILDATVPGSSHVHLLSAGVISDPHQR
YNERALAWVAAETWHYETTFELPAHRPCHLRAATIDGPATLFVNGVEVAATANSFLAYAF
DLTAYVHAGRNHLSFVFEPPLAYTARLAAAYPYYVPATINPNTWAEPTHRPFLRKAGSDF
GWDWGPAFVPVGLAGPVHLVLPSACAARLDEYTIDQTHAPDMSFAHLVFRGFIDGVCNDS
ALALHVRLGNVTVAVAVAPSTSKPAYLEATYTLQNPELWWPKGYGRPHLYDVELLLTTTS
GTRLDARRGQLGIRSIVLDQSPANPTGHHFRFIINGRRIFVRGANWVPSNVFPTRTTHAT
LAHLLTSASTVHMNMVRVWGGGRYESDAFYSFCDAHGLLVWQELMFACAAYPRDASFLKT
VADEVRYQVRRLKKFTSLVVWGGNNENESIMDQFANGWFLPDGNVFNRDRAVTDYVKVFV
DTVAPIVLTADPGRPFLDSSPSNGVLSTSPYVKRWENTSSVDDGDVHYYNVVRDCMDWTQ
YPAARFVSEFGFQSMPSAAAWATVTDASDWATIDAMHAMLAFRQRSPNGTEHIQHQLDLH
FASLPTTGSVAERLRAYTWLTQVQQGLCYATAIGTWRRLGATGVLYWQLNDVWVGPSWSS
IDVHGHWKALHAMVRAPFAPQATIVHEDATTGSISATIVSDVNATVVVHISLYRFAAAAT
ALKVLDTTVAVDSESAVVAWHVESVTDLLAAHDCDRAACFLTVASPSLDDEVYHFFRPFK
DLPLLPAVVATTIVEANVTSWSFQVSCVSGHPALFVTLETAVVGQWSANVLHLRPGSSRL
VTFWPATPTPLAPVTTTHLFDAYTPSAHETSAA

Enzyme Prediction     

No EC number prediction in SDRG_15444-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	84	765	1.1e-77	0.6303191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.21e-67	84	880	19	763	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407625	Ig_mannosidase	4.52e-09	846	921	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
395572	Glyco_hydro_2	5.22e-06	296	374	26	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55460.1|GH2	0.0	60	923	7	862
CCA25641.1|GH2	1.43e-188	76	904	57	959
AAH65988.1|GH2	2.22e-137	54	889	14	864
AAH45360.1|GH2	1.68e-136	83	889	42	864
NP_956453.1|GH2	1.68e-136	83	889	42	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DDT_A	6.21e-119	84	909	18	850	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
2VJX_A	1.02e-86	82	901	13	814	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.06e-86	82	901	15	816	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.08e-86	82	901	15	816	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.73e-86	82	901	13	814	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q29444|MANBA_BOVIN	1.84e-122	84	909	29	861	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
sp|Q95327|MANBA_CAPHI	9.80e-122	84	909	29	861	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
sp|Q8K2I4|MANBA_MOUSE	4.14e-118	84	909	29	861	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
sp|Q4FZV0|MANBA_RAT	4.34e-118	84	909	29	863	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
sp|O00462|MANBA_HUMAN	1.13e-117	71	909	22	861	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999141	0.000856

TMHMM  Annotations     

There is no transmembrane helices in SDRG_15444-t26_1-p1.