CAZyme Information: SDRG_15288-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_15288-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
188		21356.59	4.9230

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767219:4274-4837(-)

Full Sequence      

MTSDGFLLETYEAAIDGIEQHLLSRSVEVDKVSGETTTYFYLKELSIPAMSGINQQDHLL
CFVPGMLALGTVGEVDAVKVARHLDLAKKLMATCYAMYARQPTGLAPDLVAFPGFLVRDG
KYKLRPETIESLMYMYRITKDEKYREWGWEIFQSLEKHAKTTYGYGAVLHVESLEQVTVE
DKMESFFM

Enzyme Prediction     

EC	3.2.1.113:99

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	7	188	1.1e-43	0.40358744394618834

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	5.47e-61	4	188	231	420	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.51e-53	8	188	309	485	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55877.1|GH47	5.13e-83	1	174	317	489
CCD28278.1|GH47	3.55e-61	40	188	6	154
CCD28123.1|GH47	1.98e-60	4	188	117	293
UIZ22976.1|GH47	9.57e-55	4	188	392	568
CAG4717530.1|GH47	3.71e-37	11	188	60	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	6.50e-36	7	188	239	417	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	6.77e-36	7	188	239	417	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	7.04e-36	7	188	244	422	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	7.23e-36	7	188	244	422	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	1.68e-35	7	188	322	500	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2GUY0|MA1B1_RAT	3.66e-35	7	188	441	619	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|A2AJ15|MA1B1_MOUSE	9.50e-35	7	188	442	620	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|Q9UKM7|MA1B1_HUMAN	2.02e-34	7	188	483	661	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|Q8H116|MNS2_ARATH	9.17e-25	53	188	369	504	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q9P7C3|MNS1_SCHPO	1.08e-24	9	187	285	476	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000008

TMHMM  Annotations     

There is no transmembrane helices in SDRG_15288-t26_1-p1.