CAZyme Information: SDRG_15245-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_15245-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623	JH767218|CGC1	67278.87	6.2471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767218:36839-38764(+)

Full Sequence      

MAAPTQGGGRPPYQYMDSTSHVQDDDMAHVPVWQDSSAEHMYGDYVNPGGVAVMESTEHA
SVRPSTILDSSRTSTAAAMKPDIKVGVSEEANSEKKHTGRKRVWPGWLLLFLVFGGAVFG
IFWFGRKLYFKAQGQQTLSQKILDRTPAPPTPAKICELPNFVGDGFGGVVAKYSSGLVKP
IVITGINWSGMENVEGVPHGLAFGQSTMDAISAKLVDQGVTAVRLPLNVQMILSNAAPNV
KDFVDPVVNAEFNVNTYMDMIKKVIVGLAKQQIAVLLDIHKLDPKNLNTDASEGLWYSAT
VTEAQTIKAITMLATTLCNANYYNVIGIDLKNEPHKGCWPASATTADPSCPTTNNWQQGA
TRLGNAMLKACPKWMAYVEGTLEQIETAYPNTNGGSKLSYGDWWGASLNNVSTNPVVLSL
KNKVVYAPHFYSPSVYPAAYYFAVQDGDKSIFTEFPNDADGNAKLQSNVYAALDRSFGKA
MAAAKAPVMFGEFGGIYGVNDKWPSKSSTRAIEAFVAYSQDRNMSGGFAWSLNSESFYEY
NPSKGEYMYGLYTDNTWAAYNEDYSAALRKFKGSGTIFCVKVDASSVVDAGDTDTSGSAT
SGVVTVPPTSSKTPTPTTAKTTL

Enzyme Prediction     

No EC number prediction in SDRG_15245-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	180	536	1.5e-121	0.9912790697674418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.71e-20	175	570	39	389	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	9.50e-13	195	536	11	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABL75348.1|GH5_20	8.08e-147	29	579	17	566
ABL75347.1|GH5_20	6.31e-145	29	579	17	565
UIZ24458.1|GH5_20	1.79e-141	32	579	17	562
CCA26601.1|GH5_20	2.14e-135	32	579	22	563
CCA27479.1|GH5_20	3.29e-128	32	579	20	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	1.58e-32	174	536	21	350	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	2.15e-32	174	536	21	350	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	7.70e-32	174	536	54	383	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	1.91e-31	174	536	54	383	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	6.40e-31	174	536	54	383	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	1.47e-27	179	536	52	356	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	2.53e-27	180	546	61	368	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	3.09e-21	179	442	643	902	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000001

TMHMM  Annotations     

Start	End
103	125