CAZyme Information: SDRG_14587-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_14587-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564	JH767206|CGC1	62854.55	5.9939

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767206:4164-5858(-)

Full Sequence      

MKVPSVLLLALAAGHVAALDRKFYGLNYDVKPASGSGCKQPWQIQREVAAFKATTDAIRV
YATACTSDVLDAAAKNNMKVWVGLWSDLTYTHAFDGEFNNLKQLVQSKKIRNDNVAGIQI
GSEVLYRWYIQGKHDKADKTGVNWLIEQMKRVRAYLRENKINIPVTVADVMDGYNLFPEL
YEAVDVVSVNQFSMWENVKAVDGVSTLFGHWGDVTKQAKAAGKPVMISETGWSAGDDKDL
VAEASPDAQARYAKDFLSFAEKQNINYYYFSAIDLVHDADLVEKTFGMFDGNANMKPDIA
NVHVGSKPIATRLFHGDKVLKVDPANWNALLVEAPASGLGKNLDNELWFYQPDSQTYYSK
SSNQCLDAYGDSNNALSVHVYACSAENANQKWKMSDDGHLTNLNGANQCMDVDPSQDDKV
AMWWCYDGPNQKFAARPVAAEAITLGKSNTYLYEWYGDVVATSDVKYKDNAVWFYDPLHQ
TLKSKSSGKCLDGYQTENDVAVHVYDCDNANANQKWQHNDVTGQWMHASKLGLCLDTLAN
GKTHLDYCDKTKASHKWPMAFATN

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.39e-29	23	292	45	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	1.38e-17	358	516	6	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.39e-16	317	433	10	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	1.19e-12	473	557	40	126	Ricin-type beta-trefoil lectin domain.
214672	RICIN	1.70e-12	344	433	29	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56029.1|CBM13|GH17	0.0	1	560	1	560
AIG56030.1|CBM13|GH17	8.96e-242	1	562	1	576
AIG55846.1|CBM13|GH17	1.20e-210	1	562	1	567
AIG55545.1|CBM13|GH17	2.76e-159	1	559	1	568
AIG55960.1|CBM13|GH17	2.68e-154	1	560	1	570

PDB Hits     

SDRG_14587-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P15703|BGL2_YEAST	1.99e-06	13	296	18	305	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999697	CS pos: 18-19. Pr: 0.9704

TMHMM  Annotations     

There is no transmembrane helices in SDRG_14587-t26_1-p1.