CAZyme Information: SDRG_14586-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_14586-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580		63961.40	5.6138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767206:1542-3284(-)

Full Sequence      

MKVPSLALATAVALLAAPTAALDRKFDGLNYDTRGYDKDGCKYAHEVAAEFAAFKKTTSQ
VRIYSTACTGKILTAAKDAGLKIWIGLWSDVPASGVSDAFASEFKNLKQLVESNQVRNDN
VAGVQVASEALYRYYIQGKRPATDLTGYNLLVDHLTNVRSYLRSKGILFPVTIADVMDAY
NLFPAIYSAVDVVSVNQFSLWENKTAAEGVETLWWHWGDVQKQARAQGKPIIISETGWST
ADDKNLVVEASPQAQGVYTKDFLAFAEKHGLNYYYFSAIDLAIPGDLIEQSFGIFDKNIN
LKGPVQAITVGSKPIATRIYHGDNAVLKVDPTNWNALLVEAPAQGPASNLDNEIWFYYPD
SQAYYSKASHQCLDAYGGSNNPLNVHVYGCTAGNANQNWQFTSDGHLQSLNGANQCMDVD
PTQNNKVGMWWCYDGPNQKFTKRDVKDEPMQIQVNGNGYLNEWYGGVSWNPSMSATYSDN
AAWYYDPVPQTITSKSGKTCLDAYGKDNGYAVHTYACDDSNVNQKWLYNDVTGQWFHTGH
LGFCLAATGSAGDSAGISLQPCDKNQSNQRWSFKFETKIV

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.77e-28	36	298	53	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	7.17e-20	365	526	6	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	2.48e-14	405	573	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	5.24e-14	348	441	31	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	1.00e-12	348	440	33	126	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56030.1|CBM13|GH17	3.82e-309	1	574	1	574
AIG56029.1|CBM13|GH17	1.89e-264	1	572	1	558
AIG55846.1|CBM13|GH17	1.41e-208	1	575	1	566
AIG55545.1|CBM13|GH17	2.03e-163	17	572	12	567
AIG55960.1|CBM13|GH17	5.93e-163	1	572	1	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.59e-23	26	302	37	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	9.85e-23	26	302	37	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

SDRG_14586-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999720	CS pos: 21-22. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in SDRG_14586-t26_1-p1.