CAZyme Information: SDRG_14180-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_14180-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704		76324.42	7.3291

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767199:190266-192623(+)

Full Sequence      

MKAVSAWSGTAGLGAVAALAAATFANTLSCGFVWDDRAAILTNRDLRTDETSVWDLWSHD
FWGMALTSPTSHKSYRPLTVLTFRVNYALGGYNPMGYHLLNVLLHIAASVLVVVVGRRVV
APFGASNTPVLAGLLFAVHPIHCDSVASVVGRADVLCTCLSLLAFCLYDASASATCTNWP
LYTASLVCVLAATLCKELGATTLGILVALELLRTAPPPSRSKRLGLSAGVVRVALLLGLG
SAAIASRIALNGDQTLYAWSIFENDVSLLPWGLPRLLTTLHTHGWYLYKLVWPQYLCYDY
GFRTIPIISSLFQMENLGTVLAYAALLVLLRVAFDRRQTSPLLLLTSFGLFPFIPAANLL
FPVGTIVAERLMYFPSVGFCFVLGYALDSALRWSSETRLFEASVLTAPWSVKVLSNLSKV
LLGPDPPRAAAYLERALSVAPRYAVGHLNLGLAYAGMGKPLHAMQNLLDSIDVDPSLAAY
GYLGRYASSFYLTSQHEQFAMSNATHARKLAHHLLDHAIAQGASMPGLFFMRGLLAYYTK
DFVTAVTYFGATVQANDVVRARGYDLEELVTPCAAQNMLALSLDESGDVDGAFNLYMEYV
QAQSQCLEIYNNAAMRLRDRGRLDEAAQLLTTGLHRFPDSVILLMNAAQVAEDRGNDVEA
YSLFLKGFAIDPTNESLLAKHANLVPKLAKPLQSGTVAPQPMAS

Enzyme Prediction     

EC	2.4.1.109:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	85	214	1.3e-35	0.9236641221374046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
276809	TPR	3.15e-08	575	666	3	94	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
400627	DUF1736	2.75e-06	259	319	6	66	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
274350	PEP_TPR_lipo	2.86e-06	406	692	358	587	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
276809	TPR	6.91e-06	608	678	2	72	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
411342	gliding_GltE	1.64e-05	425	485	271	330	adventurous gliding motility TPR repeat lipoprotein GltE. GltE (also called AglT) is a tetratricopeptide repeat protein with a lipoprotein signal peptide and a role in A-motility (adventurous gliding motility) in Myxococcus xanthus and other delta-proteobacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7262601.1|GT105	1.86e-61	22	454	17	490
AAI66274.1|GT105	7.13e-61	16	475	25	509
Q5T4D3|GT105|2.4.1.109	9.48e-60	16	465	26	503
BAF83034.1|GT105|2.4.1.109	1.30e-59	16	465	26	503
BAC25886.1|GT105	8.83e-58	24	465	33	503

PDB Hits     

SDRG_14180-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5T4D3|TMTC4_HUMAN	1.68e-60	16	465	26	503	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q8BG19|TMTC4_MOUSE	1.29e-57	24	465	33	503	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q6ZXV5|TMTC3_HUMAN	1.92e-56	22	477	18	513	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q8BRH0|TMTC3_MOUSE	1.05e-54	16	477	17	518	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q7K4B6|TMTC3_DROME	5.60e-53	26	465	50	569	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.421936	0.578062	CS pos: 29-30. Pr: 0.5007

TMHMM  Annotations     

Start	End
12	34
94	116
228	250
308	330
342	364