CAZyme Information: SDRG_14034-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_14034-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	JH767197|CGC1	25104.56	7.9278

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767197:163415-164221(-)

Full Sequence      

MQEVKDELAKAKITVPVTIADYADTWAANPSMVEAVDIVSANQYPYWEKKNANESAAWFY
KRMEPVIASAIKYKKKILISETGWATGGFAAKAGPSTPAQAAKYLNDFSLLAKQMDWNYY
YFTSFDMAFNSNETDTDNVEQHFGLFYANGTMKPCYANLTVTGTSTVVTKAPSQLATVTP
APKASSANKTDNATATIKPTTTTVPGATPKSAAMGAALTSLVSMAVASVVMLAL

Enzyme Prediction     

No EC number prediction in SDRG_14034-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	33	153	4.5e-16	0.4533762057877814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.49e-18	4	149	161	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	7.37e-04	27	153	174	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56195.1|GH17	8.30e-89	2	232	143	409
AIG56392.1|GH17	1.26e-44	1	172	146	319
AAY53769.1|GH17	8.32e-44	1	172	146	319
AIG55390.1|GH17	1.21e-41	3	172	151	322
UIZ28880.1|GH17	1.41e-34	11	153	151	294

PDB Hits     

SDRG_14034-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DEV5|BTGC_NEOFI	9.25e-13	1	154	511	675	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	3.08e-12	1	154	511	675	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	3.08e-12	1	154	511	675	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|A1CAI0|BTGC_ASPCL	3.04e-09	1	145	518	673	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgC PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	1.42e-06	4	153	145	300	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SDRG_14034-t26_1-p1.