CAZyme Information: SDRG_13883-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_13883-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: cytochrome c peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	JH767195|CGC1	37469.42	9.1022

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767195:120322-121338(-)

Full Sequence      

MFRNAASRATRIAARAGAPRLLARSMSVAARQSSASKATAMAGAFLVTTGVTASLLQAQE
AKVNLEKIRKEIVDLIDDEPAMGPTFVRLAWHSSGSYSKHDHSGGSKGGTIRNEPEINHG
GNAGLNLAIARLESVKARHPEISYADLFIYSGVVAIAEMGGPEVPFHLGRKDAKVGEQVT
PDDRLPAGDKGSKPSTISHIRDVFYRMGFNDREIVALVGAHAVGRCYPSRSGYSGPWTRA
ETTFSNEYFRELIENKWTIKKWKGPEQYEDPTGDLMMLPADMAFLWDPEFKKYVELYAKD
EDLWHKDFAKAFQKLTENGCDFAKSGWRRYIFFGPRSD

Enzyme Prediction     

No EC number prediction in SDRG_13883-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	67	319	1.1e-55	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	6.95e-135	58	323	6	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	3.45e-79	65	320	14	244	L-ascorbate peroxidase
173823	plant_peroxidase_like	1.79e-64	66	317	1	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
178467	PLN02879	5.90e-62	59	319	11	246	L-ascorbate peroxidase
166005	PLN02364	3.38e-58	58	319	9	246	L-ascorbate peroxidase 1

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22874.1|AA2	3.30e-138	40	336	45	342
BDA47129.1|AA2	2.51e-93	66	322	89	348
QKY15243.1|AA2	7.33e-91	56	322	99	364
QRD85779.1|AA2	2.30e-87	66	332	96	358
QMW29426.1|AA2	2.30e-87	66	332	96	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AL9_A	7.17e-78	58	319	1	258	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
4GED_A	9.52e-78	58	319	1	258	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AMM_A	1.01e-77	58	319	1	258	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIV_A	1.05e-77	58	319	2	259	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
3RIW_A	3.36e-76	58	319	2	259	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	5.08e-90	66	332	100	362	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	1.09e-85	78	319	131	367	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	2.97e-84	78	332	105	353	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	3.78e-83	38	338	62	362	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	9.48e-83	61	335	80	354	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SDRG_13883-t26_1-p1.