CAZyme Information: SDRG_13822-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_13822-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		40641.84	6.1009

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767194:223179-224336(-)

Full Sequence      

MRLAFAASIASLVVGEDLRYQTNALAYAPRPGLNAIEAALGANLPALELITVSNTTAPLR
ILCWVNTYEKTHARARAIKKTWGQRCTKLLFMSNVEDDAIPTVRVVAPATHDHLWQKHRF
VVRLLAREYDASEYDWIFKCDDDTYVIMDNLLSYLHSVATSMTSPDEPRLLGHRMTLQWF
EMQKPFRDLSYMQRDRRQALETVLRETRHQGGLYYTPGGAGYAFNSAYLTQLVAALDEPS
CLPDEVVPDDWAISFCMYHRGVVPVDTRDSLHRERFHQYSPEQVYYWPDDVNDFDHWNYA
SIYEAQNWFSDHIGIGWRNGSDCCAPDSVSFHYVHDMHLVDAYFELRKNAQK

Enzyme Prediction     

No EC number prediction in SDRG_13822-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	8.22e-09	65	313	10	244	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56499.1|GT31	1.38e-192	1	348	1	360
AIG55580.1|GT31	4.56e-123	40	344	24	341
UIZ24342.1|GT31	7.90e-121	38	345	29	339
CCA20921.1|GT31	8.06e-118	53	344	3	297
AIG55842.1|GT31	2.12e-58	46	341	40	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4I_A	8.56e-32	59	341	27	263	Chain A, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7K237|C1GLT_DROME	1.60e-30	59	341	99	335	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=C1GalTA PE=2 SV=1
sp|Q5F3G7|C1GLT_CHICK	2.97e-30	59	347	88	328	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Gallus gallus OX=9031 GN=C1GALT1 PE=2 SV=1
sp|Q9NS00|C1GLT_HUMAN	2.75e-29	11	334	28	311	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1
sp|Q18515|C1GLT_CAEEL	2.99e-29	48	335	93	332	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=C38H2.2 PE=2 SV=2
sp|Q08BL3|C1GTA_DANRE	5.12e-28	59	334	92	315	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A OS=Danio rerio OX=7955 GN=c1galt1a PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.784431	0.215596

TMHMM  Annotations     

There is no transmembrane helices in SDRG_13822-t26_1-p1.