CAZyme Information: SDRG_13381-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_13381-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	JH767190|CGC1	89656.71	5.9851

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767190:108401-111074(+)

Full Sequence      

MTWTVGLAVAAAITASCAGDDSLRWGTYHSGLYFGVRSRTHPTHVSAGLLWTSANEDVSQ
LKHECSERDRLESYGWTKHNGRSFGQQTIRDRLNRMAIETTFLKPPAHDGSVATKSWASR
ITVAPLYAEKGLPELASLFFYLDVGCGDDQIGHACRDEVLQHLQWTIDEPSPCVEPMTSN
DVTCLELSVRAEHATDATLNFATRVQAHVTGDVPSLHFWGDAGVNVVNVKDRLVQLAART
PGGDMAIVLPDDVDDESSIVVLQLRYDPRRTSDVALHIVYNEATDDDDLLQSTPIAVYND
VIDDYSAQFGRHFEATFGLAATSGDAKQIALAEAAFSSLIGGIGYFYGSIYLEDHDRIDE
TAPLPLYSAVPSRSFFPRGFLWDEGFHQLGIVHFDPVISMDVLSHWLHTMDDRGYMAREQ
IRGHLAQKRVPSEFLVQHASHANPPTLLLAIEKLAHLERARPWLLAHWPKLIQWFQWFQT
TQSGDVNHTFRWRGRHNDGRLMPNTLASGLDDYPRASSPSDDERHVDLLAWMAKAASVLA
TVATAIGHDGSTYTALHATYLEALDTYHWSNGLYLDYGLHSADGHFEDHIVIRCATVDGA
GIDATASARQLQRGDGSDVCPASHPRFLYPLGDGAGGLLKKQIFVPKTLRLQFVEHIGYV
TFFPVFLKLLPLDSPKLRPLLAKLETHLLTPHGLRSLSPYDVYYDRPNAPGDAPYWRGAI
WMNLNYLALESFSFYAAEASDVSTRAAFADVYARLRTAVVSTILAEYERTGYFHEQYNDV
SGKGQRCHPFTGWTALVTNILAERY

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	379	801	3.3e-23	0.356140350877193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	2.32e-178	297	803	5	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.98e-31	23	141	1	116	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.13e-04	663	746	485	565	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
283786	GDE_C	8.58e-04	663	763	238	347	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56123.1|GH63	0.0	10	805	8	797
AIG55648.1|GH63	0.0	2	805	3	797
UIZ28949.1|GH63	1.27e-219	24	805	65	896
CCA18876.1|GH63	9.07e-174	20	805	65	967
CAB1328239.1|GH63	8.17e-131	25	805	96	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MHF_A	9.65e-119	14	805	28	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
4J5T_A	1.29e-77	20	803	12	802	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q80UM7|MOGS_MOUSE	1.72e-118	14	805	83	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	2.40e-118	25	805	94	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|F4HTM3|GCS1_ARATH	2.19e-115	21	805	107	849	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.21e-113	14	805	85	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|Q84M89|GCS2_ARATH	2.26e-111	21	805	44	786	Alpha-glucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GCS2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.009754	0.990235	CS pos: 17-18. Pr: 0.9423

TMHMM  Annotations     

There is no transmembrane helices in SDRG_13381-t26_1-p1.