CAZyme Information: SDRG_13010-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_13010-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	JH767185|CGC2	50541.24	6.8675

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767185:387100-388841(+)

Full Sequence      

MRGLAFVAVVVAAVAHAAAAGMGVCYDIYDANNIDKHFRTIKTRFSAVRTYQTSLWTPRN
VIDAGADNGLAVYAGIWLRDGMDFNKELQAVIDGHYRHPGTLQAVFVGNEDLMNNWNQWA
IRDKVNAARSRLRSAGINVPVGSVQTDGDWLKNRDLANACDIMGVNIYAFFGGSPVSWTN
PIADLDARWKAMTQAFGGNKVMLTETGWPHGGGNNGNHVSNRGNAIDYFTKVQAWVNAGN
GGAAPMYFMFHDNRRKYGFEGQFGLADADSNWKFDFGSSGPAPIVDDDPRLSSPFQLITS
RNKALREFYGAAAAKDNNQDKFTLWSYDRSSQTLRNLGANQCLDAYYESNGRPRVHLFAC
DGNNDNQKWRVVDNKVLHARFSNLCLDADPNDPNEAVQVYACVGNNDNQVFRISDAVQHV
RLQSPAFNRALGVGENDQCHDASAVWVKYQQLEFQV

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.27e-23	38	269	69	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	9.29e-17	333	446	4	115	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	4.51e-15	315	411	34	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	6.59e-14	333	433	2	99	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	9.62e-13	316	413	33	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56197.1|CBM13|GH17	1.44e-186	19	438	26	441
AIG56231.1|CBM13|GH17	1.14e-185	19	383	15	368
AIG55519.1|CBM13|GH17	2.69e-177	22	438	18	440
AIG56198.1|CBM13|GH17	2.98e-134	19	382	15	380
AIG55595.1|CBM13|GH17	1.13e-127	17	424	13	432

PDB Hits     

SDRG_13010-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1C499|BTGE_ASPCL	1.03e-10	22	265	309	554	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|P53334|SCW4_YEAST	2.07e-10	23	232	135	350	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|B0Y9Q9|BTGE_ASPFC	2.40e-10	27	265	321	554	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	2.40e-10	27	265	321	554	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	1.28e-09	27	219	308	502	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999762	CS pos: 19-20. Pr: 0.6291

TMHMM  Annotations     

Start	End
7	29