CAZyme Information: SDRG_13009-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_13009-t26_1-p1
• CAZy Family: GT66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558	JH767185|CGC3	61255.32	6.8497

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767185:384579-386255(+)

Full Sequence      

MLPRAVLSVLLLAAAALAAPRGVCYDAYNSDSASAHFASIATRFDAVRTYQTWTHNSNLI
DIAARNGLAMYPGIWLRGNGVDFWADLRAAVDGTKRNPGTVKAVFVGNEDLSNNWNAGAL
LDKINQAKNAFRDAGLGYVRIGTVQTDGDWLNNNNAWLADHVDVVGVNIYPFFGSHPDSW
NNPVKDLDARWNAMTNRFGSKVLLTETGWPDAGGNVGAHVSNWQNAQNYFRSAQSWMDGN
KGGELPTYFMYHDNRGKPNYEGHFALAEPSGQWKFEFNAKKNPSNNNGGGNGNNDGDKPA
GQFQLMTSRGKALREWYGGLAAKDNNNDAYTKWTYDANAQTLKNEGANKCLDAYMDGNNV
KVHLYNCDGNNSNQKWRLVGGKVVHARFANVCLDADANDPNEGVQNWACVDNNSNQVFKI
STGGSGGRVALTVRSLNRVFAIGSNDQVLFRSPQGSIQSDTNALWTLDSNTLVKSAANGQ
CLDAWEAKNGGGVHTWNCDGNNANQKWNYDASTKQLRHATHNGFCLDMGSENGDHPQLWQ
CHPANDYWAKFQQYAQES

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.02e-17	20	239	45	271	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	1.28e-16	341	507	4	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	2.99e-15	459	547	34	123	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.91e-13	348	508	10	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	1.18e-12	344	508	3	116	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56198.1|CBM13|GH17	1.08e-207	11	388	8	379
AIG55519.1|CBM13|GH17	1.93e-181	22	557	19	552
AIG56197.1|CBM13|GH17	7.11e-176	7	554	15	547
AIG55672.1|GH17	1.22e-172	9	365	6	363
AIG56231.1|CBM13|GH17	5.51e-142	10	387	7	365

PDB Hits     

SDRG_13009-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QH21|EGLC_ASPNC	3.89e-10	60	240	77	273	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|Q0C7P6|EGLC_ASPTN	5.49e-10	18	230	18	263	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	9.12e-10	44	230	56	263	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	6.55e-09	44	230	57	263	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|Q5BD29|BTGE_EMENI	6.55e-07	44	260	326	537	Probable beta-glucosidase btgE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=btgE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999742	CS pos: 18-19. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in SDRG_13009-t26_1-p1.