CAZyme Information: SDRG_11488-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_11488-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	JH767173|CGC1	86880.45	8.9619

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767173:177915-180248(+)

Full Sequence      

MAIGTVLVLLCQAWRLFLALTSEPWSLPLTQFVREPTLSARPPRTVHLASSTPWANASTS
VTLVSWPGRRVSYNTTPMTVATSFGDVVYNKTCNETWFAPPRNLPRGLNVPIPTNRWWGN
WIAYSENHTDVCAWASPYAICLFPTSIGVWYPPDRRVFGNFSGIGDSPQYYYHDIASDVV
LSAAEVNKTKGARFQVVSWDDLGVTVRASVGNHSMASSVVTGMAYFTATYKGLSPLLRAN
RTITAINGVNVSAGMVFNASAKLSLTLNNSRTWIVYASPPVTWRLTRAMKLRAAPYHGHI
RIALAPDGDDVYDAHADCIVNGGRVDLAATSYSFHWNTSGACASGLLHFGLQHHIDTLDT
TTARQLATPRLESSTRGWLYPLVSPRLRWTFHERSLVPATFLPRIPAPHARLVRANLTAI
LKDDILSNWTMEVNGSYYFNGKAAQKFASLCLMASDKTVVGNASAYLRTCRRKLEIALTR
FIDNTWTFPLVYDGLYRGVVSSQGFAQNETYADFGNTMYNDHHYHYGYWVTAAAIANHVH
PNWTRLPALNARVETLIRDVANTNRSDLAFPIFRSFDWYKGHSYSHGATAMTDGKDQESS
SEDINFHYGLTLFGRVTKRRHIETLGQLMLTLNARSARTYFLMQDDSTVQDARMRPNKVL
GIIFDNKVDYTTWFSNETHCIHGIQMLPTTPVTEFVRTTQFVREEWTQVLSTLPIVTNDT
IANNNTWASIMFLNYARLNPDAAIAKLATVPMDDGLSRSWALYMAASQPGEPHTESS

Enzyme Prediction     

No EC number prediction in SDRG_11488-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	108	763	8.3e-169	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	4.33e-142	417	762	10	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	7.72e-124	100	772	78	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.63e-35	109	403	12	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56513.1|GH81	0.0	1	768	1	769
AIG56018.1|GH81	1.07e-303	86	768	70	755
AIG55599.1|GH81	4.87e-282	86	768	72	754
UIZ29875.1|GH81	4.87e-193	76	769	80	793
UIZ20872.1|GH81	2.84e-189	100	767	106	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.71e-101	112	769	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.53e-100	112	769	66	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	5.05e-97	112	769	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	7.07e-25	104	743	14	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.30e-15	517	756	436	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	3.74e-89	99	772	23	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	2.87e-87	111	768	225	902	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.69e-78	108	766	78	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	1.46e-71	101	762	421	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.80e-70	101	766	447	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.990301	0.009708

TMHMM  Annotations     

There is no transmembrane helices in SDRG_11488-t26_1-p1.