CAZyme Information: SDRG_11479-t26_1-p1

Basic Information

• Species: Saprolegnia diclina
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia diclina
• CAZyme ID: SDRG_11479-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
129	JH767173|CGC2	14291.04	8.2761

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SdiclinaVS20	17448	1156394	89	17359

• Gene Location: location=JH767173:143100-143553(-)

Full Sequence      

MSHTSLTSSEPRKSMTRAASRGALQLTWRYNYEAFGGAIGRDLVTNYASVATDQDLVWLS
AFWFWSANRIHDVAGQWGQFAKTTRIINPTWECGPNPPNPNGDPHRVALFKAYCAELGVD
PGTNLSCKV

Enzyme Prediction     

EC	3.2.1.14:44

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	20	127	2.1e-27	0.5281385281385281

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	2.22e-26	21	127	106	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	4.37e-22	21	127	110	232	Chitinase class I.
225720	COG3179	8.20e-08	21	88	119	184	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55723.1|CBM18|GH19	2.41e-51	21	128	222	329
AIG55559.1|CBM18|GH19	1.92e-50	21	128	222	329
AIG55513.1|CBM1|GH19	1.40e-38	21	128	112	223
AIG56150.1|GH19	1.18e-32	21	128	98	209
ETV63620.1|AA15|GH19	4.52e-32	21	128	427	538

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7F88_A	4.39e-20	21	127	88	197	Chain A, Chitinase A [Gemmabryum coronatum],7F88_B Chain B, Chitinase A [Gemmabryum coronatum],7F88_C Chain C, Chitinase A [Gemmabryum coronatum]
4IJ4_A	5.16e-20	21	127	96	205	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	5.27e-20	21	127	97	206	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
3HBD_A	3.00e-18	21	127	100	204	Chain A, Class IV chitinase Chia4-Pa2 [Picea abies],3HBE_X Chain X, Class IV chitinase Chia4-Pa2 [Picea abies],3HBH_A Chain A, Class IV chitinase Chia4-Pa2 [Picea abies]
2CJL_A	1.16e-17	21	127	94	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P42820|CHIP_BETVU	4.97e-21	21	127	187	288	Acidic endochitinase SP2 OS=Beta vulgaris OX=161934 GN=SP2 PE=1 SV=1
sp|P29023|CHIB_MAIZE	3.91e-20	21	127	168	269	Endochitinase B (Fragment) OS=Zea mays OX=4577 PE=1 SV=1
sp|Q6K8R2|CHI6_ORYSJ	1.59e-18	21	127	168	271	Chitinase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht6 PE=2 SV=1
sp|Q7Y1Z0|CHI5_ORYSJ	7.49e-18	21	127	187	288	Chitinase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht5 PE=2 SV=1
sp|Q9M2U5|CHI5_ARATH	3.26e-17	21	127	172	273	Endochitinase EP3 OS=Arabidopsis thaliana OX=3702 GN=EP3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994782	0.005232

TMHMM  Annotations     

There is no transmembrane helices in SDRG_11479-t26_1-p1.